SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 6238.CBG07054 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  6238.CBG07054
Domain Number 1 Region: 1-192
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 5.11e-40
Family Calponin-homology domain, CH-domain 0.00082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 6238.CBG07054
Sequence length 203
Comment (Caenorhabditis briggsae)
Sequence
MANHGPSYGLSRELQKKNDARFVLEEAIEVLTWIENVTGERFSFDVTTCESSTDVSNLLK
DGVMLCKLIEKLDPQCRVVYNKKPKMAFPMMENISNFLAAAKRFGVMEISCFQTVDLYEN
KQCYKVIECLRLLAAVAQMRSSHLDHPAWVVKLAQSSPRQFPEAVMRRGEMVIPLQYGTN
KCASQKGMSPYGLPRQIKPDPHG
Download sequence
Identical sequences A8X3T4
CBG07054 6238.CBG07054 XP_002632191.1.8413

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]