SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 6238.CBG07809 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  6238.CBG07809
Domain Number 1 Region: 2-105
Classification Level Classification E-value
Superfamily PapD-like 9.81e-27
Family MSP-like 0.0000335
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 6238.CBG07809
Sequence length 108
Comment (Caenorhabditis briggsae)
Sequence
MSLTAEPASCTIPANGGTSSLKIANSGTDKLIFKIKSSNNKDYRIQPVFGFVEPSEFKEV
TVIRLSGPPKEDKIVIHFSIAPVDVFDASAAFATVTPAGTFTIPMSAT
Download sequence
Identical sequences A8X576
6238.CBG07809 CBG07809 XP_002631859.1.8413

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]