SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 6238.CBG09326 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  6238.CBG09326
Domain Number 1 Region: 155-558
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 5.89e-60
Family Calponin-homology domain, CH-domain 0.0025
Further Details:      
 
Weak hits

Sequence:  6238.CBG09326
Domain Number - Region: 1035-1048,1082-1240
Classification Level Classification E-value
Superfamily ARM repeat 0.0219
Family Armadillo repeat 0.088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 6238.CBG09326
Sequence length 1275
Comment (Caenorhabditis briggsae)
Sequence
MDSTIERKREAMLQRLASRNEKRTLEAAAAKETTKKIDLRATEKAFLESSPTSINLKTPV
NPPSNYTISTPCSSSPILSFDEKAEKQMVALATWTNTMIGLDSTEELDLGATAAEACRRI
QKMLGRKNEASEADRVHQAARQRYQRIFEKNDPDVMRKKCKKLLDDSGIEESIRDMLSKN
QITIRNEHSVFNDLALQTNLLRTFLCFHPAWLKVTIEAIFGARIDAQPKYMIRALSQFFI
ERVFSNPSMLKNKKFAQGSGKPIITKQGREALHRHFLETTMKLMFLIETANAHRVIPNLT
RIFTKSSQYKCLDDMFSGLTKELLTGSSLTFKKAFAKIGFTPSYKQSFFDNYDYQAKGFA
DYSDGIILAKLIESVGELPHGELLLKLRDPAGDRIRKINNVKIVLQEMTSIGIPTEDVTP
TAIVGGTKDAILAILWSIVGVRVAREKRVKISRAVDETPKKKRRSAVHDNMSSDVLKTCK
LYGRQLEQEVLDLDSLTDGILLDKIWKSCIPNATPISAYSGDSLWEKVVSMAELELGINR
GLDQSIALFVKMFLDRMQTVKMYHEKAAIIQKQWKLYLERKNIPKLFFIVQQVLVNHRQQ
RCISPATTIDNATFVIQNTPGILTERPSLSQLPCTPRSMNSTLNDATFTLSRDSLQYPEI
DTLSNCFKQPKTPLRGTFTRHTISKHLNEVIEEEEGSENDETVVPSTLKKRFRVDLLTTQ
QKTTVFQEENAGIIECEETSYSREIHTVASVRVHNSEEVYAGESPEIDGKGIETLNISSD
DVQNADCEEVIEDLEASSESITPDKNNEEASEDHENAHGPVEISPEDVNVLKNDFTPEVL
ENDIVADEVSTEANIEPQENVPATLPMDHTQPTSSQSTSSSLVDYEMTEEQKKSEAMFRE
MIENQKRYVLNNQLNLVIPDQSDTASTPELRKILRETRELKRKQEEVAKRLGAIERKALA
EKENAFIEYSTTDEIHMNENDVNDRPDAGLDNAVIQHDSVSGSLDQLERSADLLRSTSPT
GIFEKLNNDDDAEKLAKKALEELQTKQRKSAVTIQKVVRGFLARRRFATEIRDWREKMVA
YNMILAQENEQLDEDNSQKDETKGNSSAERKLRKCTRRLIHDNLHIVLLAATVIDRLTNL
VPSLLDTFVIELNGIKPIYEILAVADQGFAYTSILSPLLKILQKSLLNVPEETSNPIIRP
LLQKLSPRLVLLMCKHCQNQEFFTPIVTSLISIARRFPHKKDSFIEADYAIRQTMKKVLD
KDGRNYLTTLQNVSE
Download sequence
Identical sequences A8X9D0
CBG09326 XP_002636868.1.8413 6238.CBG09326

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]