SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 6238.CBG10466 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  6238.CBG10466
Domain Number 1 Region: 7-89
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 9.27e-25
Family Nuclear receptor 0.0024
Further Details:      
 
Domain Number 2 Region: 173-270
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 3.73e-16
Family Nuclear receptor ligand-binding domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 6238.CBG10466
Sequence length 277
Comment (Caenorhabditis briggsae)
Sequence
MENEVPDCEICGLPSQGTHFGVLSCKACSAFFRRTATSPKWAPKKCQTPKKCQPGKGMYH
CKPCRLKRCYDAGMDTKKFQFDRDGLIQVPNKLSRSFEVFVGRPDYVLFCTPGSSEDSSE
NLKPKTIIDVSYLVNMASKILLDGPEQPLIARDQLQKLANGFSYLKNTSTEMRDFSHSTK
EDVMKIWEFYFLTVAKWLTYFDEFQKLDHDLQMKLLLAIWHVWGRLDKLLATAINRRRGI
CPTKNLLTLSNGVFIDMEKQEVDVEWMTNYEPEQVLT
Download sequence
Identical sequences A8XBA2
6238.CBG10466 CBG10466

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]