SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 6238.CBG11578 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  6238.CBG11578
Domain Number - Region: 11-99
Classification Level Classification E-value
Superfamily Snake toxin-like 0.00366
Family Snake venom toxins 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 6238.CBG11578
Sequence length 121
Comment (Caenorhabditis briggsae)
Sequence
MKFLLVIAILALWIQATESTTCFVQNSIPSVFTQVCPGNIYTCMKFDCRVNNPKKFKQTT
KGCNDPGNPQVACTQLMTQCQAQGGTGQCYTCNGDYCNSTTTTFAALLSISIPAISFFLL
H
Download sequence
Identical sequences A8XDJ4
6238.CBG11578 XP_002637713.1.8413 CBG11578

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]