SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 6238.CBG12279 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  6238.CBG12279
Domain Number 1 Region: 6-110
Classification Level Classification E-value
Superfamily PapD-like 6.28e-26
Family MSP-like 0.0000352
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 6238.CBG12279
Sequence length 112
Comment (Caenorhabditis briggsae)
Sequence
MDNSQNVTVDPTTATFPATGGNSIHFLSSTAESRIAFKVKCSNNDQYRVRPVFGFLEIKG
RTKLEILRLDGPAKDDKLAVLWAEVPADEIEPWAPFKAGSQMGDITIQLKAT
Download sequence
Identical sequences A8XF59
XP_002642692.1.8413 CBG12279 6238.CBG12279

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]