SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 6238.CBG12581 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  6238.CBG12581
Domain Number 1 Region: 146-244
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.0000000000165
Family Calponin-homology domain, CH-domain 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 6238.CBG12581
Sequence length 335
Comment (Caenorhabditis briggsae)
Sequence
MSEEIKKIEEVAEEKAPEVPTTEPPVEAAAPVSEEAQKVEEGAAEATPAAEGEAAAAAPE
EKKKSGGVARRFTFNKRWGKHRDAEAAAPKEPEAPKDPKEDVLGWIAQQIPQAVHKANFQ
VIDWVQKTAIPEEGDRKTIPGKDQATTRNQFLGFFKDGDVLVKLANALEPGAVEVATAEE
NADAAAQKEVQKKNIDSFGAWAQKTLGTETAPVTSDDLLEKGKAGYSAVFQTLWQLGVQA
KEKFDKEGFNVETIVQLANTVVKSGLLNTILGFFRRNRQAAAAAEEPKDDAAPAAVEGTG
EAAKEEGATGEVTDTADEPVAVKQETSAPAAVAAN
Download sequence
Identical sequences A8XG35
XP_002640094.1.8413 6238.CBG12581 CBG12581

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]