SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 6238.CBG13946 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  6238.CBG13946
Domain Number 1 Region: 111-601
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 7.32e-159
Family Calponin-homology domain, CH-domain 0.00000000189
Further Details:      
 
Domain Number 2 Region: 2-72,402-431
Classification Level Classification E-value
Superfamily EF-hand 0.0000000535
Family Calmodulin-like 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 6238.CBG13946
Sequence length 623
Comment (Caenorhabditis briggsae)
Sequence
MLSREQLQDLKENFPTVSESGSGFLPRSDVQTALKILGIDVPGYKMRELMDQHFGNEAQI
DVDKFARLFDTLDAQRNEEANRWKQQTKQVSGAYHTHSSKQENVQHTIRVEEEVAFSNWI
NSNLSDDSDLKRLLPVGSGELYTKIQDGLVICKLINLAVPGTIDERAINKRNLNTYTKLE
NLTLALMSSQAIGCNIINIDNIDLSKGTAHLVLGLLWQIIRIGLFNQIDLQHCPGLFRLL
RDGETLDDLRRLSPEEILIRWVNYHLERAGTSRRLHNFQSDIVDSEIYTYLLNQIAPHGS
GVTLAPLNVQGNVPRAGAMLDEAEKLECREFVTANDVAAGNYKLNLAFVANLFNKHPMLP
DPGADEVVEDVVEETREEKTYRNWMNSMGVDPYVNWLYGDLQNGVVIFQLYDIIRPGMVT
WKRVVRQFHKLRGMMDQIQNCNYAVELGKQLRFSLVGIQGKDIYDGNQTLTLALVWQLMR
AYTLSVLAQCTQSGDSLPADKDIVAWVNEKLSKSGKSTSIRSFQDPAISTGKVVLDLIDA
IKPNVIDHSLVKPGTTNEEKMSNAKYAITCGRKIGAKIYALPEDIVEVKPKMVLTVFACL
MARDYMPDMKEVSAPVVPMINGN
Download sequence
Identical sequences A8XIZ0
CBG13946 6238.CBG13946

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]