SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 6238.CBG15975 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  6238.CBG15975
Domain Number 1 Region: 954-1092
Classification Level Classification E-value
Superfamily PRC-barrel domain 3.22e-55
Family RIKEN cDNA 2310057j16 protein (KIAA1543) 0.000096
Further Details:      
 
Domain Number 2 Region: 157-250
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.00000000000641
Family Calponin-homology domain, CH-domain 0.0084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 6238.CBG15975
Sequence length 1099
Comment (Caenorhabditis briggsae)
Sequence
MPDKLRDGVQRDENGHFQIDEAVLGALCNGSLYAQAAAKIFKESALVTKGHGAVLAVLTD
YGIDVLHDGNELVEESQLIASSPFNMVIEILKLKKSMNVEFSVRPSCNHRCIDDGTPTRH
PKTKNLFSSRHTAVEPSEKPIDIRDDVEREDSVTNIPEMEDLYEDISDGQCLCALLHWYR
PQEMPVADISFNEAATTRDCQYNLMLLQQFCHHHLANDPFHFEIEDLLYLRDSLQMNVNA
FLADLFVQFEPPVTPEPVETPRVGPSPRRFVPASAIPDLRAANAAARSSMHNRNRPRMYN
PPPPASHSQGPSRSVSRMSQDSLFYSRPASITLQRRSMDQDSVTDFQTIRQGFENQAGTA
QLNRYDGSVTASVRLAMEEKRRKHDQQMAQMNSANETERLEKSKAAFFALRGKNENDQGN
KGKEEWYDHFEAKLRALELRVGLEDGEDGTQSARLNRASSQPSVVQAAGQPYPANYMTLP
MNAAAQMTQSYIQHPQTPHDYYMQQQLQQQQQAQAQGNYASPSQVSTKALKTLYIYVFQL
RNSLSNGMINHAGYMVQSMYPGDYQQQQMQMQQGQMPVQPVGAYTPEGYFIPHHMQPISV
QQGYPPMQQAGMGFNGMAATNQPGYNLDGSPAQMGYIQTANKPLDMEMPMQQQPPMPQQQ
QAQQQMLPPNHNAFHLHSKSDDATQADPPLEINRNLTNWGMTYKQEMPARSIPSRRTWQN
ETFIKNELDLVNSKESVPHITDETTTQPEEAARRFPELMLDNHSENLAPGRNYSRHSDRD
DLSTGRKSDDSPTDTPGRTFGDDELTGENMEKIAAERRIAKKAALIAKTMKRKEEIETKV
DLAEQRNAERRQVENEKKELALRKKVEKEQQRQKILEEYKRKKLEKELGAELSARSTGRG
HSQPPFIRTKSQMSEVTESRQNTPRMRGQSSVEQRVSVSSLAEPSEYFCCLVGQTHISAH
KLFAKTVTKSNRGLINNALQFSVFPGAVNNATRQTTIAQMASSSSKHFLILFRDQKCQYR
GLYTWDEVSDTACKISGQGPPKCTEAMMNMMFKYDSGAKNFSQIATKHLSATIDGFAILD
QYWQKPRIPHSGTPAHKNN
Download sequence
Identical sequences A8XND4
CBG15975 6238.CBG15975 XP_002643365.1.8413

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]