SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 6238.CBG16145 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  6238.CBG16145
Domain Number 1 Region: 9-223
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 4.11e-61
Family Calponin-homology domain, CH-domain 0.00012
Further Details:      
 
Domain Number 2 Region: 970-1081
Classification Level Classification E-value
Superfamily E set domains 4.34e-18
Family Filamin repeat (rod domain) 0.0028
Further Details:      
 
Domain Number 3 Region: 605-705
Classification Level Classification E-value
Superfamily E set domains 2.2e-17
Family Filamin repeat (rod domain) 0.0035
Further Details:      
 
Domain Number 4 Region: 706-800
Classification Level Classification E-value
Superfamily E set domains 9.35e-17
Family Filamin repeat (rod domain) 0.0018
Further Details:      
 
Domain Number 5 Region: 1098-1180
Classification Level Classification E-value
Superfamily E set domains 0.0000000000000327
Family Filamin repeat (rod domain) 0.0077
Further Details:      
 
Domain Number 6 Region: 241-328
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.000000000000432
Family Calponin-homology domain, CH-domain 0.0061
Further Details:      
 
Weak hits

Sequence:  6238.CBG16145
Domain Number - Region: 527-586
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.023
Family beta-sandwich domain of Sec23/24 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 6238.CBG16145
Sequence length 1279
Comment (Caenorhabditis briggsae)
Sequence
MGKQGEEARQKWIDIQLHTFTNWINEQLQGNVIQDLTQDLSDGVNLIRLVEILQGRRYYG
KVYDQEPTEIQKLMNVQMALDALREDGVKTVNIGSHDIVDGNEKLILGLIWCLVQRYQIA
CKTKIPPKKLVMAWIQSALPELKLTNFRTNWNDGIALSALLEYCQPGLCPEWRNLDPSAA
RENCHRAILLAERYLEVPGIISSDHLSSPHLDELSCLTYLSYFITKGAPGYRATLKKVSL
LLPDCNVEDLEHSWSDGFLLAHLVEACGGSVPEIERMRFENLNDFVENVAVVLDAAADIG
VGSLIGADDIADPQGEHLGTMALVAALCSIPLEQQVKYTDCYVNQQVNLDLAFTSGNEVR
IEELDVQVVGSTGEIYSNEAIQLRKSRTSQGANLSLIPVEQGFLQNIPNKMSETVGYESI
RQKIQSRFYHTVRIYCQGSELPASPIQLQVHTQEETRSTSRAASRAHPENRNPGATTSTS
TVRTTVSPVRAPKQEAGKVAQISSETEVDISHKSFAQRRLHIIKQLEAQHVNHIAQTKSH
HQPQQQQQHHQPQPHQQSPSIVQVVLPTPPPPPTSAQNSSHIPPAPPIPAVLEASAYREM
PLTRSPDVGLVSFSGLSEPCSVGSIVEVVINAHGDAVSGSVYVEAVSPSGTVHPCTVRHQ
NNTYMATFTPQEVGLWRIGILYDGEHIRGSPFACQVFDSGLVNVYGLDVGLVGQELRFSV
NTSQAGHGNLSVTVLRHGREIPLNIEEQGNSKNHQVSFIPDGAGQYKIHVLFNRMEIKGS
PFVLDIADASSVSTYGENLRSASVGKTASFMVHAVGHHRVASSQPKSSHWTMSRLKSNGR
QMNQEEVIDITPNVIGQYLFLLPPPPLMGVLLLAIVSTSERWPRKLSVLSLFHLRFFFFF
FRRLLLFLLPIIDYLLMTRHAHNNLMILIRPPLVSFCLSSVFCQCHSFKMILGVNSYFIT
LCFPGEHSVDVMLADQRVPDAPFACNVGAPDLVHVRNMPRRIVPSKLNTDHSFEIDASAA
GSGNLEIMINGGRVPCRVRELGSRQYMAIFTPTQSITHTIEMRFNGEHVSGSPWKLPVED
RGERRQEMERTMSYYSELSGPGLVRAPVNRVAHFDITGEGLELSDIQAKIVGPDNKEFPI
RIIPRSSGKYTAEYEIEQVGEHHLTVWIAGRKVDGSPLSVAGKAGISETNLKNWTNTVVT
QPKKFAWNRWVEDRQISQYSSMRRNSVFVFPPFYLLLPFTTFFSFQLNSSLKKKVPENCY
SLLLYLLVHKITISIYAAH
Download sequence
Identical sequences A8XP09
CBG16145 6238.CBG16145

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]