SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 6238.CBG17250 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  6238.CBG17250
Domain Number 1 Region: 47-92
Classification Level Classification E-value
Superfamily p53-like transcription factors 0.0000000323
Family T-box 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 6238.CBG17250
Sequence length 212
Comment (Caenorhabditis briggsae)
Sequence
MNLTLDHDNKNLKTQSACNQSNNPIEHHCYMSKDITENIRKLENGDENPNFDEEFRIQNV
WFIAVTTYQNPAIKCLKVENNKMASGFRSTGNHKNSLPTRGTKRTASETFPTPPSSTSPP
SKMNSNGHFSNAHYSNQENFDFSMTGNSHQYWMNPDQNTWIYRYNMEQQMEQPVINQWNM
QNFGHPTNLNYEQYGNPNNTIGPEFYHGLNNF
Download sequence
Identical sequences A8XQH5
CBG17250 6238.CBG17250

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]