SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 6238.CBG17972 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  6238.CBG17972
Domain Number 1 Region: 4-122
Classification Level Classification E-value
Superfamily PapD-like 3.14e-30
Family MSP-like 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 6238.CBG17972
Sequence length 123
Comment (Caenorhabditis briggsae)
Sequence
MTEKKQFIATEPCDKIKFVAESQDEQKTTLKITNQSEMKQAFKVKCTRNDLFRIKPSTGI
LDYNQTITVILIYKGGQTKPPTEKQQFGVYHIPAPENCTCEGAWAEHYGPPQGEHKLRVV
WNE
Download sequence
Identical sequences A8XSQ1
XP_002642036.1.8413 6238.CBG17972 CBG17972

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]