SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 6238.CBG18782 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  6238.CBG18782
Domain Number 1 Region: 54-207
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 4.19e-25
Family Calponin-homology domain, CH-domain 0.00016
Further Details:      
 
Domain Number 2 Region: 1307-1406
Classification Level Classification E-value
Superfamily RGC domain-like 9.81e-23
Family RGC domain 0.0019
Further Details:      
 
Domain Number 3 Region: 781-1080
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 0.00000738
Family p120GAP domain-like 0.0096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 6238.CBG18782
Sequence length 1406
Comment (Caenorhabditis briggsae)
Sequence
METNQHEGPEEEIIHQNGLSSSCSFLPPPPPSENLPSPTTSEAVEDVDERRLNRVAYEYL
CRCEEVRTWLSECLKDDSIASITELEENLRNGVLLARLGHSFAPQIVPEKGIFDINQEKY
KQNESIPVYRHSDNIMQWRRAMESVRLPEIFIPETADVFEGRNMKTVFCLFALATLLHRQ
RKAPPMRNLAGKAKFSTTELGAAKENLKDSKLPEFGDIGNMLSDRKNDATAQAVAMEILR
EAVNEMDSKKVLEILKSAPAAIDYVEETMGEQYLDGLKEGAEPFTKVYVQSVINSANTKS
AMDQLEALLLSVDVDNSQIIHILDLLQIEDVRQFATSLYIDLLRKSKDEQLSSGDQVRDV
IAHANALVEVRIAVEHGSSGDVLKALQNPHLNLEDVEKSNSTLYYNRLKKEFEGVDDQKF
LVREQLAEIVSDYSSISPERRMILELNGALTRGDSEGVEVILKRVSLEFYVEENLEFYCK
RLGKKKAGNLEELKNELEDVNLEVEKAFKLAEQVLKINKAKGSEEKIQKALRGLKDLEAD
GYRKELIQWYSKKLLEVLETSENSKDGWMEQDFSLGTVYVSTTTPTERSKVAQSPINPNY
LNWAIIHFHLIKENKDFDEYFKKNESEVVKGQNALRKFLEQKRAAKEAELKKEQDEAAAK
IQSRYKVYRNKKDLELLKTTTTPSLSLVRKFVNQLPRGEVDFTDDLEVAESKTEVSRLMA
SNRQLDKNLEEMDENIGLLIKNRLNLQDVIAHRDKTAASAEDFAAKTEVSNKKQREKSSV
ESLEQLLYYLQTKPNYLANLIEGLRENRTEMMTDVVSPIFGFLSDNREQFLLVRLLCELL
GRNVAQLRQIEDFHSNYFMQATADTVKLSTFDNILSDPCQSIIDELTNYVDEESRVKTFH
LDPVDLYQNLYGRSVESVEKALQDTTVSDILSSSISFLAKWSERFMDAVFENYKLPKSCV
YMTSYLETALRHQFPAATAMQIDQTVAMFAFKVFLSHHLTSPRSLFRALGIQITDDATHR
LEAIIQFTENAVANKGYANKLWFLSRLNANVHVIHRKFIEYINKNVRNVVLDEIYSMNEF
TQFDPFHKPTLSLIDKHLQTVIECLRKHKNDISEGNEDQIVQLIESIDDVATSDGVVMLQ
LHPSPNEMLPDGTQAHLFTRAKKQVVELLLEGVPGTDVEQLVEQKEVTPAMQSIQTNLKK
DLAQLEDDGRTSKSDKYQSIVTDIANDIRLHERRQRERAEQKKSIAATRRKLMEQREELN
EKLARYEEYLETCLQNLSRTSRRLSFRPNTKEAGKIQKERASLDQIKTYKSSAEKLFKKG
VIKEILGYQTPKRISKLTVEISSSEESGVFSMILTEGKQQIGDATLQFQDLLKSESLSEP
IYTINKLVVLDVKKAIQYINKKFYNK
Download sequence
Identical sequences A8XU39
6238.CBG18782 XP_002646409.1.8413 CBG18782

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]