SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 6238.CBG23504 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  6238.CBG23504
Domain Number 1 Region: 24-255
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.74e-88
Family Calponin-homology domain, CH-domain 0.0000151
Further Details:      
 
Domain Number 2 Region: 271-394
Classification Level Classification E-value
Superfamily Spectrin repeat 3.14e-32
Family Spectrin repeat 0.00000555
Further Details:      
 
Domain Number 3 Region: 509-630
Classification Level Classification E-value
Superfamily Spectrin repeat 1.57e-23
Family Spectrin repeat 0.0000239
Further Details:      
 
Domain Number 4 Region: 395-504
Classification Level Classification E-value
Superfamily Spectrin repeat 4.06e-23
Family Spectrin repeat 0.000011
Further Details:      
 
Domain Number 5 Region: 633-745
Classification Level Classification E-value
Superfamily Spectrin repeat 7.2e-17
Family Spectrin repeat 0.0000338
Further Details:      
 
Domain Number 6 Region: 737-857
Classification Level Classification E-value
Superfamily EF-hand 0.0000000000000351
Family EF-hand modules in multidomain proteins 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 6238.CBG23504
Sequence length 894
Comment (Caenorhabditis briggsae)
Sequence
MVDYYQQPPSYHQPGYDYTQQEEEWDREGLLDPAWEKQQKKTFTAWCNSHLRKAGTSIDT
IEEDFRNGLKLMLLLEVISGEPLPKPDRGKMRFHKIANVNKALEYIESKGVKLVSIGAEE
IVDGNVKMTLGLIWTIILRFAIQDINVEELSARDGLLLWCQRKTAPYNNVNVQNFHNSWK
DGLAFCALIHRHRPDLLDYSQLHKGDPIHNLNLAFDIAEKHLDIPRMLDAEDLANSQPDE
KAVMTYVSCYYHYFSGMRKAETAANRICRVLKVNQENEKMMEDYENLASDLLAWINRWMP
WLANRSTDDTLRQAQQKLEDYRNYRRSEKPPRIEDKGRLETLFNTLQTRLRLSNRPAFCP
RDGHLVKDINAAWAGLEDSEKGFEEWLLSEIMRLERLEHLAEKFRRKCALHEEWAHGKED
ALRSNDWRSCGLYKIKALRKRHEAFESDLGAHQDRVEQIAAIARELNNLRYPDIGPINAR
CQAICSQWDRLGQLSSKRRETLEDAERIAERLDSLYLDFAKRAAPFNNWLDGAREDLADL
VIVHEMREIEELVSAHDQFKSTLGDADREFSSINQIEHEVEHLVTSHGLDRELLRNPYTD
LSASDIRRKWGEVQSSVPRRDSQLQSELKRQQNNERLRTIFAEKANQVGPWLERELEQVL
AIGLGGRGRLEDAIQQLRSIQRNVLGYKSNLDELERIHQEMQENFVFENRKSRYSMESLR
VGWETLLTSINKTINEFENQVLLRDSKGISEEQIAEFRASFSHFDKERAGLDPEQLRACL
ISVGYTIRPGREGDAELHRVLAHVDPNRMGRVPFEAFLDFMTKENSDQDTVEQMIDSFRI
LASGKTFITAEELERELPRDQAAYCMARMAPSREPGAPPRSFDYVTFSRSLYSQ
Download sequence
Identical sequences A8Y3R8
6238.CBG23504 XP_002636771.1.8413 CBG23504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]