SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 6239.B0035.3 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  6239.B0035.3
Domain Number 1 Region: 24-194
Classification Level Classification E-value
Superfamily Macro domain-like 1.14e-56
Family Macro domain 0.0000268
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 6239.B0035.3
Sequence length 203
Comment (Caenorhabditis elegans)
Sequence
MAAAKISEIPTLFEKFKVAKNVLGRISVWDGDITKLSVDAIVNAANSRLAGGGGVDGAIH
RAAGRKQLQEECQQYNGCAVGDAVITSGCNINHIKKIIHTVGPQVYGNVTDERRENLVAC
YRTSLDIAIENGMKSIAFCCISTGVYGYPNDDAAKTVTNFLTEYLEKNDTIERIVLVTFL
DIDNEHYNKYFGDYAASKDQSIA
Download sequence
Identical sequences Q17432
B0035.3 B0035.3 B0035.3 6239.B0035.3 283985 B0035.3 NP_502127.1.50509

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]