SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 6239.C16C4.10 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  6239.C16C4.10
Domain Number 1 Region: 5-126
Classification Level Classification E-value
Superfamily TRAF domain-like 2.13e-30
Family MATH domain 0.0079
Further Details:      
 
Domain Number 2 Region: 143-261
Classification Level Classification E-value
Superfamily TRAF domain-like 4.09e-29
Family MATH domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 6239.C16C4.10
Sequence length 282
Comment (Caenorhabditis elegans)
Sequence
MTNSCKEFVISEHIKNISRFVAEEYYFTNTEERFNIPWRMRIWKKNGYFEFYLRCEKEEC
ENRKWSIETEFTLKLISCNGKRLTKTDNYTFEKPEERGWSEFIRWKELECDYGVDDSIVV
EAHVKIIKITYSPCIENENQKIFLLHHTVKNVSSIKEGGNYFTNTEKRFNIPWRLQIQRF
NEFFGLYLRCEKELSNRRNWTIEVEYDLRLVSLNGQSLSIKGTSTFEKPISYGYCKFIRW
DDMENKYMVNDSVIIGALVKITKMTGCEEQTSWSWMINSMFA
Download sequence
Identical sequences O16558
C16C4.10 C16C4.10 6239.C16C4.10 NP_494108.1.50509 C16C4.10

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]