SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 6239.C45G3.1 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  6239.C45G3.1
Domain Number 1 Region: 152-537
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 6.82e-56
Family Calponin-homology domain, CH-domain 0.0032
Further Details:      
 
Weak hits

Sequence:  6239.C45G3.1
Domain Number - Region: 676-720,1009-1153
Classification Level Classification E-value
Superfamily ARM repeat 0.000403
Family Armadillo repeat 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 6239.C45G3.1
Sequence length 1186
Comment (Caenorhabditis elegans)
Sequence
MDNNVEDKKEAMLKRLANRHEKRLLDQVKSNTKKIDLRATERAFLESSPTSMNMRTPLNP
SISSSVSDSPILSYDEKANKQIIALATWCNTMMELDVSEEMDLGESKAEACRNIQKMLKK
RSDTSEVENTQENARRRYQRIFEKNDPEVVKKKCKQLLDDSGMDASIKDLLSKNNVAIRK
EHAVYNDIGLQTTLLHTFLSFHPAWLKTALEAIFNTRIDAQPKHLMKKLSQFFLDLVFSN
PTMLKNKKFAQGSGKPIITEAGKEALHKHFLSVSMKLMFLIETAHTHRVIPNLTRIFTKS
SHFNCLDDVFSELTKELLTGSSATFKKAFAKVGFIPTYRQSFIENYDYQAKGFSDFSDGL
ILAKLLETVGEMPHGQILLKLRDPAGDRIRKIGNVKIVLQEMSSLGVPTDNVNAESIVGG
KKDEILSILWAIIGVRVAKEQRIKVTRVSEERTPKKRRSAVHDDMSSEVLKMCKIYGRQM
EIEVMDLDSLSDGCLLAKLWTTFGTNSTPIQDYDGLSLWEKVVSVAELELCIQRGLDQNM
ALFVKMFLERLGMIQDLNEKATKIQRMWKAYVQRKNTPKLYFIVQQLLADSSIPRNRSVS
PFSNNVTFTVPRTPRNNILTERPSLSQIPSSRQSMDSTFNDATFTVSRDSIESMNKMQKT
PLRGTFTRKTIAMVIEEEDDSENNETVVPSTLKKRTVVRMEHNAEVFREQDEDDENQDKD
TVAPSAENLDSPPSDIPLETLSSIPSASQSAIFLQDSETGKEMHVPKAEDVGVVVLEASD
SPVALEGNNEASYDGQKIENLETFEIKEGKTQEDLPSKSPMDPTQTSGSPLVEFRMTEEQ
ERLEMLFQSLSEDQKNFVKTNNLSVSIEDDANTPELRRILRQTRELKRKQQEIARKLGNI
ERNALAVRDGGEDSSDSRSDAGHDVAILHGDDSQLFENSMQLDQKSQLQNDETQILENKK
KAAVVIQKMIRGFIARRKFQMEISNIRNRMIQYNHILAQEDEQIGIEEMEDKSVEAKLKK
CALHGLTNDNLHVVHVAATVIDRVTDLVPSLLEKLVVELNGIKSITDVLIVADRGFSYTS
ILHPLLNVLEKLFTKIPEEVTNSHILPHLKILSPRLMLLMLKHSEVKELFIPIINTLTSI
ARRFPDKKQSSFSSSSYSIKQSLKKVKDQECRNKLVRLESICEDML
Download sequence
Identical sequences O17666
6239.C45G3.1 C45G3.1 C45G3.1 NP_492467.1.50509 C45G3.1 C45G3.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]