SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 6239.F14H3.11 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  6239.F14H3.11
Domain Number 1 Region: 8-93
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 5.91e-23
Family Nuclear receptor 0.0014
Further Details:      
 
Domain Number 2 Region: 94-331
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 7.14e-22
Family Nuclear receptor ligand-binding domain 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 6239.F14H3.11
Sequence length 345
Comment (Caenorhabditis elegans)
Sequence
MTKKSTIQPCLVCGQSSNSILFGAPSCRACGEFFRRKVISNFKIKNNCLGECSFAKKSMK
PCQSCRFQKCLEAGMLEKMVFSRKAIYSISNFEKSILEELEEAYSKLEHGRNETFNPKSD
SNPKFCSHEELNNTCTIDIQIILDNLISYFQAKKPMGKEQDDVLKMHFIVPFVLFDTAFR
AIGKSSYISPDGTMFGGSYVEKLYQDSSNSKIGVNNGKTSREIMESYWKVSYKILKSEME
LLQLDRSEFLLLSALIYWDFGLENQSDKCCENCNTIREKVLKELVKYERKKSGQNALRIA
MIMGLLQAVPKALDVMKTCGFLSKIYNLRGSGCPLYAISTNSPPQ
Download sequence
Identical sequences O45365
F14H3.11 F14H3.11 F14H3.11 NP_507045.2.50509 F14H3.11 6239.F14H3.11

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]