SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 63737.Npun_R5088 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  63737.Npun_R5088
Domain Number - Region: 4-53
Classification Level Classification E-value
Superfamily Mitotic arrest deficient-like 1, Mad1 0.00654
Family Mitotic arrest deficient-like 1, Mad1 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 63737.Npun_R5088
Sequence length 168
Comment (Nostoc punctiforme PCC 73102)
Sequence
MKKILDTDKKPILLKVSLLQPTPVTTAIVPLQPQQEKIISERERLITQVERINQMAGELE
AAILELKAIANTLNSQKRYPLLKKELGKQICQYFAISVPWVKRKPDESFILTTRKVDLFR
AEREAALLAQQLRQQTKKRLASQRHRKNKNGAETDTRHFCKKALVNKS
Download sequence
Identical sequences B2J236
gi|186685169|ref|YP_001868365.1| WP_012411376.1.44837 63737.Npun_R5088

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]