SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 644223.PAS_chr1-4_0533 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  644223.PAS_chr1-4_0533
Domain Number 1 Region: 272-471
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 2.36e-42
Family DBL homology domain (DH-domain) 0.00011
Further Details:      
 
Domain Number 2 Region: 471-514,557-618
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000448
Family Pleckstrin-homology domain (PH domain) 0.026
Further Details:      
 
Domain Number 3 Region: 735-825
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.000000000072
Family PB1 domain 0.0057
Further Details:      
 
Weak hits

Sequence:  644223.PAS_chr1-4_0533
Domain Number - Region: 172-243
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.000445
Family Calponin-homology domain, CH-domain 0.0084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 644223.PAS_chr1-4_0533
Sequence length 838
Comment (Pichia pastoris GS115)
Sequence
MSHLHIPPLRSNASSSLSIQQLRTPSAPMAAAPLIMNKQADAEESLYFIALKLKSRLAKI
SGMLKYLNLAATSTELTSERQTMMLAQQLSESKLGMYSSSGVGNRNSNGLDFVDSRRSSS
TNNGSISSTRNSSGYQLSKTTTNTTTLDFSYGSSSLQTFVAGILPAQSSSDPVTTIWKLF
QQGAPLCLLFDSIKPGIVKVVPSDELKICKMSIYEFLSACQTHLSLDGVELFTVTDVFTN
DTNSLLKIIKVVNFLLDKYSNIVADPVDAELKVSDARSKVVRELVETERKYVLDLEILLK
YKTELERKEEISLEAIRNMFPSLNEAVDFQRRFLVGLECNAAVPDRYQRIGSVYLHGALN
AFRLYETWAVGQYSSIRFIQKEIASLRKSSTLIDANYELQSFLIKPIQRLCKYPLLLKEL
VKLTDESFPNYRELCTALEYSKIVAHDINEAQRRAENAELVKDLITRVKTWRGYDISTFG
DLLFHSNLTVIDSDTERDFKVYLFQTILLFFKEEMPPLQTKKSMLSTRKKSSASLASSSH
QSLPNGSQSSLGGVPPSELILKGRVFVAYITNISTTSSTQQGHCMAVTWSGNKDSGTFVM
KFRSDETRSQWEQTLRKLSLRNDEPNYANKRLSSQDIFKLNLGRQRSESTMSNGSAHKMG
SVSGFTPSSLNSMSSNSYFVPPSNLHSLYQDDMVKRSVSSPNSVVSTATTLSRNHSVSSM
FPDINTYNSSSTTNSKHKNERETEVRIKFIYDNEPTHLSVPSSISFHELKLELIKNLRQN
VGYELPEYESFRFKFKDEDDDYVRFQSSDDWVIAKEMLEEISDEEQRILEIVCQSAKI
Download sequence
Identical sequences C4QYR2 F2QPX4
644223.PAS_chr1-4_0533 gi|254567111|ref|XP_002490666.1| XP_002490666.1.19831

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]