SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 644223.PAS_chr3_0326 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  644223.PAS_chr3_0326
Domain Number 1 Region: 70-172
Classification Level Classification E-value
Superfamily Oligoxyloglucan reducing end-specific cellobiohydrolase 0.00000000122
Family Oligoxyloglucan reducing end-specific cellobiohydrolase 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 644223.PAS_chr3_0326
Sequence length 237
Comment (Pichia pastoris GS115)
Sequence
MTSLQTAVCTVSLSAVVLGYEFEGVLFLFILLINISLAVPMECKVLSASQRLDDSVVQNV
YLEAGDDDALSAETILLRTQRNNVYVSYDGGIVFHQIELRDKGRIIDIIVNKHFPAYVYL
ITVDGYIYISSNGAVSFKRVKAPSKRSVDFALMKNPLSFHKYDPKKFIYAGMKGCHFWNN
VADCRTSSVNSLMLMERHLQIHVCLLALIILNLIDEKCSVILSNPSKLLMSCGTNYR
Download sequence
Identical sequences C4R478
644223.PAS_chr3_0326 XP_002492543.1.19831 gi|254570867|ref|XP_002492543.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]