SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 66084.WRi_007690 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  66084.WRi_007690
Domain Number 1 Region: 32-125
Classification Level Classification E-value
Superfamily Coiled-coil domain of nucleotide exchange factor GrpE 1.18e-18
Family Coiled-coil domain of nucleotide exchange factor GrpE 0.0029
Further Details:      
 
Domain Number 2 Region: 126-182
Classification Level Classification E-value
Superfamily Head domain of nucleotide exchange factor GrpE 1.44e-17
Family Head domain of nucleotide exchange factor GrpE 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 66084.WRi_007690
Sequence length 189
Comment (Wolbachia wRi)
Sequence
MSDSSKEKKKKFADMVSRQKGDDQQSDNHKQTDDLNEDLNTLKERAVQLEDHLRRAVADN
ENVKRIMQKQISDASDYAVTKLARDMIDSCDNLKRVMEILKDGDPVHEGIKVAYQKIIND
LKKHGIEEVDPLGELFDSNLHQAVVEREDNEKKPGTIVEVLQTGYTIKNRLLRPAMVILS
KKSADCGSD
Download sequence
Identical sequences C0R3M5
gi|225630517|ref|YP_002727308.1| 66084.WRi_007690 WP_012673267.1.1538 WP_012673267.1.47613

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]