SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 665079.A7EPR7 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  665079.A7EPR7
Domain Number 1 Region: 174-332
Classification Level Classification E-value
Superfamily Functional domain of the splicing factor Prp18 1.44e-52
Family Functional domain of the splicing factor Prp18 0.00024
Further Details:      
 
Domain Number 2 Region: 106-153
Classification Level Classification E-value
Superfamily PRP4-like 0.000000000102
Family PRP4-like 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 665079.A7EPR7
Sequence length 340
Comment (Sclerotinia sclerotiorum 1980 UF-70)
Sequence
MDFASLMSKEISKKTESSADTSKKYMKRSEIEAERQAKYLAEQRAIETEREAKLVQKRKR
EEEEEEANKAREEKRRRLAEESRKQREEREAEEERKRRKRLGLPELVKQDVEEVEEDDIP
DEELIPKLREMGHPAKLFAENHKQRLRRYRKLGVVMTTGPIPTTLVLVEEKDMKVETVPK
DEEGRKYLFRQLASYFTMVLTEWEQALEKEKRDTFASKAAYNAMVQSKENMTPLFRKFEK
GDLDEGILEPIVEIVKAAQEKRYVDANDGYLRLSIGKAAWPIGVTMVGIHERSAREKLHE
TDKGHVMGDEITRKFLQSIKRCLSFAQVRWPPEDIRQLMG
Download sequence
Identical sequences A0A1D9Q5M1 A7EPR7
665079.A7EPR7 SS1T_07316 XP_001591870.1.14510

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]