SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 665079.A7F2A6 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  665079.A7F2A6
Domain Number 1 Region: 1115-1249,1281-1486
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 3.02e-70
Family p120GAP domain-like 0.00079
Further Details:      
 
Domain Number 2 Region: 307-464
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 4.6e-37
Family Calponin-homology domain, CH-domain 0.0000167
Further Details:      
 
Domain Number 3 Region: 1702-1802
Classification Level Classification E-value
Superfamily RGC domain-like 1.12e-29
Family RGC domain 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 665079.A7F2A6
Sequence length 1803
Comment (Sclerotinia sclerotiorum 1980 UF-70)
Sequence
MSYRHLLRQTQSDSTTTANPNTTKRAPSNASTASSAYSNSSSVYELSRTSTLSSTTSSGY
GSHRKGLSEATGMYTSSENRSGKGSIESSPDSAYKNVRKSLRPLAQPPGQTSPERDKTPV
QHNRGKSVDMIRNNFQPHSRTQSVDVQKAPIKQHNRGKSIDVSKLTLFESPLQSPISPAI
SPTRSPTRRPPVVRPNSMLLSRSDSISIGGGALSKLGPLHPHTPLTRPELQSFERSSTSQ
LRTLSKFAQTATPDDFTITSPEQEVAGLHGRRRLQRSAISKDKNGTLSKPTGGYGWEGRN
WMDKQRQFLQAYEYLCHIGEAKEWIEDILKREIPPTVQLEQTLRDGVTLAEVVEALYPER
RIRIFRNPKLQARHWDNIAQFFRFLDEVQLPELFRFELIDLYEKKNIPKVIYCIHALSWL
LFRKGIVDFRIGNLVGQLEFEDHELEEMQKGLDKAGISMPSFGNMGADFGVPEPEPEPEP
VETEDERIDRELGENEAIIVELQAQVRGACMRMHLGRTMQVLWDTEDWLIDLQSMIRGDF
TRQVVEYRLNMKRFAENLQRHARGFLVRKRQSSQETFWKSHEEDVQKIQSLFRAKKVGQQ
VRDEVGMMRSALQQSEFVVKDFQSSIRGFLARKLLVAQQKETESVTVSTPVLNLQAAVRG
MLVRKKMMEQGEEISSITVSAPVSDLQAAVRGMLVRKKMMKQGEEISSITASAPLSDLQA
AVKGMLVRKKMVAQENETSSVAVSTPVLNLQAAMRGMLLRKNIAEDQEDLYREESSITAI
QGFARALLTRNQIFEQQEALHACTPIWEKLQAIARAGSLRNEVFDTQEALKSHSGSISKL
QAFLRAGAVRREVTETLSGLDEEEPLILELQSLIRGMLLRRSVEDDFDALIAEVSAITDL
QSMVRAGMVRQKTEMILDDLQANEEEIIQLQALSRAVLLRNDIEGVLGELESEEDDIVAI
QSAAKASLVRAAFLEKQRFFKENMEKVVKIQSFVRGRLQGEAYKSLTTGKNPPVNTVKNF
VHLLNDSDFDFNEEIEFERMRKTVVQQVRQNEMAEQYIDQLDIKIALLVKNKITLDEVVK
HQRNFGGHSGNLLVNTSMASGNQFDLKALNKNSRKKLELYQQLFFNLQTQPQYLARLFQR
IREQGTAEKDCKRIETLMMGLFGYAQKRREEYYLLKLIARSAREEIEHFASLQDFLRGNF
FWTKLLANYTRSPRDRKFLRDLLGPLIMENIIEDPALDLESDPMQIYRSAINNEELRTGR
PSQRALEIPRDQAIKDPETRDMFIDHLRDLREISDLFMLALESLLHRMPYGVRFICQQIF
DGLCQQFPRESQRNLLQLVGNWLFRFYLYPALTTPESMGVVERQLTPLQKRNLGEVAKVL
GQISTGRLFGGENMFLQPLNAYVTDAIERITDIFSNIISVQDAESTFDIDEFNDLYARTK
PTLYIKMADIFAIHNLICDDLPQICPNRDDVLREIIQELGSAKSNESEMLGVSSAEIQMT
LTPKLHDMEDPEAEVKALFMETKRCILYIIRVQSGPNLMEILVRPISPEDDQKWHDLLRE
EFSADSKTRGAYSDANTLTDIKSMSYWELKRTALENIMRLEQLGRISRQNYYQDILNAIA
VDIRTKSRRRVQRQRELEGVRMTLGNLGEKAEWLESQRKSYDNYIEQAMMTLQKKGVSLC
LSPKQYNHEKELERTGRTYKFGSFKYSARTLSDKGVLVAWKGYPEREWDKINLTISCDQV
GVFSIEGSKGSIVITGAVAQVPMDSLLAAQFANHQYMDMFEGAMRLNVNLFLHLLYRKFY
RTE
Download sequence
Identical sequences A7F2A6
SS1T_12053 XP_001587024.1.14510 665079.A7F2A6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]