SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 665079.A7F7P7 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  665079.A7F7P7
Domain Number 1 Region: 2-124
Classification Level Classification E-value
Superfamily SNARE-like 3.57e-28
Family Sedlin (SEDL) 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 665079.A7F7P7
Sequence length 124
Comment (Sclerotinia sclerotiorum 1980 UF-70)
Sequence
MNQFIVHSSLDIVEEVQWGGGQMYLKCIDRFYNNYVSCFMTGGNVKFMLLHSPSQPANPT
TSRTSTSIGANPTSPQTEEAIKQFFTEVYENWVKTIMSPFYQVNQPVTSPVFRGRVAAAG
KKYL
Download sequence
Identical sequences A7F7P7
665079.A7F7P7 XP_001585388.1.14510 SS1T_13627

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]