SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 668336.D11S_0716 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  668336.D11S_0716
Domain Number 1 Region: 68-163
Classification Level Classification E-value
Superfamily EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain 2.16e-37
Family EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain 0.00000265
Further Details:      
 
Domain Number 2 Region: 14-71
Classification Level Classification E-value
Superfamily Translation proteins 0.000000000033
Family Elongation factors 0.00017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 668336.D11S_0716
Sequence length 164
Comment (Aggregatibacter actinomycetemcomitans D11S 1)
Sequence
MLSAVSSVPVMKLKSWVSNRLQKTTVTGVEMFRKLLDEGRAGENIGALLRGTKREEIERG
QVLAKPGSITPHTDFESEVYVLSKEEGGRHTPFFKGYRPQFYFRTTDVTGTIELPEGVEM
VMPGDNIKMTVSLIHPIAMDQGLRFAIREGGRTVGAGVVAKIIK
Download sequence
Identical sequences 668336.D11S_0716 gi|261867415|ref|YP_003255337.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]