SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 668336.D11S_1298 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  668336.D11S_1298
Domain Number - Region: 4-50
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 0.0453
Family Regulator of G-protein signaling, RGS 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 668336.D11S_1298
Sequence length 79
Comment (Aggregatibacter actinomycetemcomitans D11S 1)
Sequence
MRLGNIYFSYKIINYEDAELANNLEKEVKEIIDSFLKNNFTYDLKLRNFSLLEKVMIFLQ
NFLKRKLKNTKKRPSLKIS
Download sequence
Identical sequences gi|261867977|ref|YP_003255899.1| 668336.D11S_1298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]