SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 67593.JGI129819 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  67593.JGI129819
Domain Number - Region: 102-134
Classification Level Classification E-value
Superfamily BAG domain 0.051
Family BAG domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 67593.JGI129819
Sequence length 148
Comment (Phytophthora sojae)
Sequence
MHLENQAKELVEYEARKAAGETEEEEDPAANSTLNSYYHFDSQGNKLKTKWDSYNVDAEL
ERLEKEERGEEVSGTAAQPKKPARKVPQLTRSKALATSQGIEHEFEAVLSFLDDVRGDDE
VKQLRKAIANKVTNEYFARIDAIQSMLA
Download sequence
Identical sequences jgi|Physo1_1|129819|estExt_fgenesh1_pg.C_90096 67593.JGI129819

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]