SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 67593.JGI134939 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  67593.JGI134939
Domain Number 1 Region: 830-951
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.00000000153
Family Calponin-homology domain, CH-domain 0.00074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 67593.JGI134939
Sequence length 1448
Comment (Phytophthora sojae)
Sequence
MGRIRGLCAAVFVFVALRQASAVRLGLTIPESSTCSHISSEYSACKVQSMCSLCVTTGAC
EFDVGSLSCVAKSTEAIANGTATTYCSTNDTACATCDVTAADPICTGEDGSCVCQSLCLV
VQPIDTSNCSSTEETAIAYIGIAVGMVGIMFFAFLGVKCRRRYLQLLRQRAFESQHRRES
EQLRMRQPQLALNLVGWRDTVEMNKPELHKLGACCYIIKGKTGDPTGAVTAISVDEAEPS
TSMETSSTLSESAVAPSPTASDHNGESFMEPLSATGGRVVPKLHLLNAGTDTDNRFSNNA
AYGGSPSTAGRVGKVMPARVSAASMEFLESPVLPPMKLRPMAGVTPSSSSSSRPAPEADS
IGASKNHRDDEAEFHVLHPAIDELADERGEDLARLLLSRWSIHSGEEQFASISLFCEMKL
NEAKRMASWAEAPNRFYTVVCCQLLEKYISRLATSKTVHNDADPVAATVGQSTAFLQRIH
AELVTSIFLPPTQAQVQDHAASGGRVDYEHRTPYFTEFKRLRRKTQALVATVRERESART
TRQQLPAKVSKLVAHLAWRRDRQILALTFRGWANAMATQRQIRASMRKMNLTAWFRVWRI
EALRRAYQRESADYQAMLSVTAASLSRKDIAIAEAEAKVTSMARIIDSLTESNKQLSYQV
DQLENLSAAAAFAGGGEGGDDNRQGFSESGTSRRRDSIDGNASHSRRREVNYERIDTMLS
QDDERMDRTNRMLLETMFGMARMVETCAIQMSKDTMDSLEYQLDGSVLQHLAEMIQTENE
LKAKADAADGTSGLTALHVSKPGGGRTSTAVTSSSSLAAATKPARARAVTVRDLAQMPID
TLLLYWFRMHLSLSSSVEKPGDRTVKNFTSDLADGRRFSFLLHRLFPSWFDATMVHELDV
DQRLQNIATFHERVQPSLPQVVTSDSIHAASGTENIAFVAMLFGTAVGTVRKLNMEKQRG
DFLNIVTTWRRVRSLLLEVKRMNDNYDAGMVAHLLKEMRTCEMLFKQLHSELDHITVTSN
EASSTLSQIAYKALSITWSCIRARDTHPNAPVGLIDERTHERVREFSRVDASCIRDLLVH
ESETAFSQLHMSAAASLQRRKSSGATPVLVAGSAMAPVVPERDVDISTAAVRRALLAYSK
DLNDIFKHYSASGGAGSLAAMSLTEFNKFIKDCFNGDKHITQEVAEKVYRAALQLDFAPT
NGTNEASSAPVGPSAAPTTATYPGTEAVDEEEPELSGRQFADAIVRLAAVKYAPMPAPRA
AGRGAHARAAPAPALPLDERFRLLMEQDILPHALRSQRELFRAEVAEPKVREVFQRHKPV
LQRVFRYYASMHALREQNSTLSLAAFIVMARDCKLIGSFVTEHTLKQVLVNLQRDDGNSS
SPPPTPGALSTEAELEMLRADFSDFQEALAALTEYVVCNPYVPLHKRVDQFLQEMLLPRA
RQKKKTGE
Download sequence
Identical sequences jgi|Physo1_1|134939|estExt_fgenesh1_pg.C_340175 67593.JGI134939

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]