SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 67593.JGI139556 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  67593.JGI139556
Domain Number 1 Region: 13-69
Classification Level Classification E-value
Superfamily SNARE fusion complex 0.0000000048
Family SNARE fusion complex 0.0055
Further Details:      
 
Weak hits

Sequence:  67593.JGI139556
Domain Number - Region: 91-120
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0106
Family Classic zinc finger, C2H2 0.068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 67593.JGI139556
Sequence length 143
Comment (Phytophthora sojae)
Sequence
MQRDDDESRLEWQRRHRQALRDTAESLQMGRSTAHTLSMQAEQLGRSERVLDETQATVDM
SKRVLRGMTWSGWLYNKFSAAPQLSPNKDAAEIAMGFICPECKVMFQSPEQLGTHYSSVH
ERRPEGGDRSRSFEKNWQSGGPS
Download sequence
Identical sequences 67593.JGI139556 jgi|Physo1_1|139556|estExt_fgenesh1_pg.C_750053

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]