SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 67593.JGI140534 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  67593.JGI140534
Domain Number 1 Region: 7-129
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 9.56e-36
Family Calponin-homology domain, CH-domain 0.0000244
Further Details:      
 
Domain Number 2 Region: 213-277
Classification Level Classification E-value
Superfamily EB1 dimerisation domain-like 0.00000000968
Family EB1 dimerisation domain-like 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 67593.JGI140534
Sequence length 284
Comment (Phytophthora sojae)
Sequence
MSRATAGATFVGRTELLAWLNALCVTRLTCVEQLCSGAVACQVLDALFPGRVPMSKVHWS
AAHEHEFVRNFKLLQQVLAALGVPKVVPVDRLVRGRYQDNLEFLQWLKELHDANVEAVAG
QQYDAMARREKGRGGAEFNRLLGDAAAAAAAATAAVVTPSKTPMKPAAGTTPRRRKGRLC
SGDDAVAVDYAAMLEKKMAGLKLQSEAAAVEQRQLATQMEELQKELASVSTERDFYVKKL
EAIEELVHNVELAKTNNAQTNMLGLAILDVLYATVEDEEEFEPF
Download sequence
Identical sequences jgi|Physo1_1|140534|estExt_fgenesh1_pg.C_860072 67593.JGI140534

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]