SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 67593.JGI156635 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  67593.JGI156635
Domain Number 1 Region: 642-733,765-832
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.0000000000245
Family Calponin-homology domain, CH-domain 0.0076
Further Details:      
 
Weak hits

Sequence:  67593.JGI156635
Domain Number - Region: 360-397
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.0556
Family Calponin-homology domain, CH-domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 67593.JGI156635
Sequence length 1699
Comment (Phytophthora sojae)
Sequence
MRAASDASRTTSKWASRASLDPFAGASTDPLDVQNGAETAALSPDQADDGKENRIPSSGR
NWGHPNVSMSRGHRQSLLEAQLLPPELNFEASAPLSLLGKRPNPDKRSPAAHRASQSDDE
SDSDTERAARNPWVASNAVAHFEQRALELHGSSLELEHTEDVGSGSATMLVDDFSHLGQL
RFGAVPLGERRGRQLTLENASELGNARIKYEGYTLVRDGSGVENAAATKSRFKCDLHVCV
VDAMKSVTLRVTFEPQQGDVGREVTAMLRFTVNDRFKLQCRATGSVTPRVPKVARFGRSR
PSRSVDTVVVVSREKQTRPPRTPAVNTRQMTSEPRSTAFTISSALSAGHHEPEQEPVVVR
PRAQRQEVYDENWMAKQTEGFTKWMNYVLLDGTAQRLSGGDAEDDAEEQGTGAKRRFDFS
SLRVLAQKRMESKWAQAAVELYHSPSMDDILFNLQDEIGNQGLLFRADRPVYADVGLQEE
LIGLLNNYHPVWLCLGLYAVLGNQVMRQEKCSLRTIFSITTAKATRKGKQESPPDRRMPQ
VLRRIILKHLVKDSHVAQNYRLVKNLLTPMDGSTADRNDGGNAFKNTKKNINGREYFDSL
TQSFMLKFFMLVIFLDLKLRVAATSANRTKPAVLVFVTEFCRLFLASEGRIDKHLKQLGY
TLRHEQTALDEIDLEIKSLETDMRDGFAGLRSKVDEKMIENLAKDIVNGHREKTLALLWK
LISSFQLQSLVDAQTMKRETENVVKRMSFRAKDFFDRQQRNAPLVHADEHECYGLLLEWC
RAVCANYDVGRHFAIINDRIKQLGEVPVLMPQQYNTKNPPEEKMVVTFVCYLQSRLMDSY
SEIHAASRLKRWWKSPLIRLRLHRKKNISARIIQRFWYTSSQKRLAIRQCRKLLRAAHLV
KSTFQMWVARIQFLRLRRSVVAIQRAFRARQQLRLNGDSVGAVLVIQYRWRKQLKWRREK
ERRLHETRQRKAAQRRELVWQSLMRAAARKQRKQEWQLVHRASQVIQRAWNIFQCRREAT
QRALALQRFELMMKEKELQKRRTKLKYKVETRAAKCVQKGFRKFALRKRDVAATKLASAF
RGAKQKLQFRKEKHAAVVIQRNVRVWRRRSHFSALTQFYSMLKTYQRMKANEAQRRALRA
QELKFKVQTRAALRIQDLYRSYRFNRRTSAATRIQSLVRARIVRSWYLHCRRSACLIQRN
ARIWRRQGQVRALLVFQNMLLRYRCMQQQETQRQERIRQERLRRLQESVEHRAAYRIQSV
YRFYAYHKKMLAATLIQAAFRGLKEQQQYAKTQLQRLRVLISCWRIEFWFRNRMMRYRKK
RALIVRARWTRLRAGIVQKRTSDVHKITRSWRSFCLRSVIDARIQHKLQMHAAAQRVQVW
WLDLCCKWAERQRRAEEQYQREMEAMAMAMAKARAARIVVRKLQAWWRGTLVRVHHSTPE
VTQQRKKLSTMKLVGQEQQIGASTSSSTSLQQLRTEQPQTLGSRLDMALHMLLHGKRLQD
MLFASHTIEVCTRYSRECCRKCVQLQISSTIFAAIRGLNRSRPHVELLHQLLLVLKNLTV
YRRSADKVKTTRAVATDDDKDRLDVDLRALDTLVDLLHIHRDMHHVFILSADVIKYYLGL
LKPLAGRNPNVQESWSEAEKRLSGLQELLSRKLALYNATASFRRVKNVPEKNSANSLMRK
MNPKTAVSIMEQLVLLLER
Download sequence
Identical sequences 67593.JGI156635 jgi|Physo1_1|156635|C_scaffold_24000013

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]