SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 67593.JGI156906 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  67593.JGI156906
Domain Number 1 Region: 470-484,520-1274
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 7.71e-230
Family Motor proteins 0.000000000329
Further Details:      
 
Domain Number 2 Region: 1674-1842
Classification Level Classification E-value
Superfamily RNI-like 3.34e-35
Family 28-residue LRR 0.033
Further Details:      
 
Domain Number 3 Region: 4-109
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 3.03e-19
Family Calponin-homology domain, CH-domain 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 67593.JGI156906
Sequence length 1879
Comment (Phytophthora sojae)
Sequence
MTVRRTEELQEWICSVTATANDHGEHLSVMLRDGQLLCLLANGVDPAASLKVNKLNTVFH
SKANIRLFLEWCKKQGLNEGEIFQPDDLLDAGADFGAVLETLSILFDRFGTIGYTGEYEE
DPVSDAESLTSTGSSQGASPVKKTNSNNKLSNFMKGGFLSRKKKQSSKKLAAEKSPEGTP
PSTPPPVSPQPPPQRSDSGGASANRLNAFLSQVPASHQSPLTHVERPSGPPKKNSVRKPP
PPKAKPAPTVRRPPSPKQPPKSQPTSGGNARNKFAAFMKSNPPAVETTHAPASASGGSNL
SAFKASVSPTSGNKPVVAAPSPPKSAPTRARGTSEQFAQRKAVFAQSGTSSPKPAPVPPK
PSVDTGSANKLNSFMKQQPFVSPDAPKPRSQSKLAAFLASTNSIPSIATTPSAAPAKPTF
ASFNPSKNAPAGGRSAPMPAYKIKEEQLRQQAAGAGNKQNLIVPGVQCYIPDKEEVWLLS
EIVDFNERRKEVTLTVFLDSGDSEQRVLNLKDPEVIRAIGGPTATEVDSLPVAILHDNPE
GVEDMRLLRYLNEPSILFNLKQRFAASKPYTYTNDIVIAVNPYKWIENLYGDHLHEQYLR
KPRDSLSPHVYSTSTAAYKHMTTNEMNQSILVSGESGAGKTETTKIVMNHLASVAGGRKD
KTIAKVIDVNPLLESFGNAKTTRNDNSSRFGKFTQLQFDGRGKLIGAKCETYLLEKSRVV
SIAEGERNYHIFYQLLAGLPSKERKEFGLDPECQYQYAGALADMQIPGLDDSKWFEGTQK
SLTIIGLDSSAQRTLFKILSGVLLLGEVMFDKSGENGSRISSGSALSQVAKMFGLPTTRI
EEALCNRTVITRNDSVTVPLAPIEAAENRDALAKTIYSKMFDWMVVKINAAISTDESRIK
GQIGVLDIFGFEDFVHNGFEQFCINYANEKLQQKFTTDVFKTVEDEYIREGLQWDHIQYQ
DNQGIVEVIEGKLGIIALMNDHLRQPRDTEEALVNKIRTNHQTKKDGKVNESIDFPKVKR
TQFIINHYAGSVTYETVGFMEKHRDTLQKDLLDLIQLSSLSLLPELFVDSEVVTEGGSGR
GKKAPKSLGSQFKTSLAQLMENIRTTNTHYVRCIKPNSNKSPTEFNKRMIVEQLRSAGVI
EAIRITRSGYPSRLTPKELATRYAIMFPPSMHSKDVRRTCSVFMSSIGRKSPLEYQMGKT
LIYFKNGVMEELEAMKSDFMYYEARTIQRIALGFLERRRLRNKINAAIVLQSYARMSLDM
KEYHFQRRAIIKIQRGWRRYKAVPVEPEYNDSWVDDLDDLDDSDADEGFGDDPASIRAGR
GRSVADRMESFKVAHSGRRGSVKRLNELSARAKSFMKPRSHSGSTSSSSGISLEDENSML
KIENRNLKYDLELMREQCIELQAIILEINKSRKRRRVFQARVRTSLRRENGIADTAACMA
LLMPDINLRRAKHQLERYWRQLLGAGERDGERKRLIFRSKSAAGAKSSQTTNPAAKRTDS
AKVTPPIQNLERDPKTEAATAGNDEIVGDSDAAQLDCGSSSLVKSNQDTDDEEEDDEEEE
LHRIQAASVECNESSAENVEVSNPDLKSKTEEAPSSTDTETSSTVSSAVTTLSSRSTTAC
VGKPPLSRVGPRVGHDNRSSYYIMPQPNYIPRVKGPTLGSILQRIHLNDGDVSELDFSTL
AQRNKRLESEGCALVARSLSTNHTVRKLIIRDHAIEDDGAVALSKMLCNNTTLEHLDLVG
NAIGDRGAEALAQALYGHDSLTHLSLANNLITDRGAEALAQAIRCNCTLRTLELTNNRIT
RVGALALLDALDVNLYVETISLDENNVPAFVESQLAAAFARNRAQALILESHAAEKKAVK
IVRRASGFDTQDEDDDSSE
Download sequence
Identical sequences 67593.JGI156906 jgi|Physo1_1|156906|C_scaffold_30000081

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]