SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 67593.JGI158731 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  67593.JGI158731
Domain Number 1 Region: 6-66
Classification Level Classification E-value
Superfamily Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain 2.09e-16
Family Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain 0.0062
Further Details:      
 
Weak hits

Sequence:  67593.JGI158731
Domain Number - Region: 188-264
Classification Level Classification E-value
Superfamily EF-hand 0.00183
Family Calmodulin-like 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 67593.JGI158731
Sequence length 265
Comment (Phytophthora sojae)
Sequence
MIYGEDQSVYDGEWVRNERSGRGSLVLANGDRYEGHWLNDKKEGPGRYFYKATRKMYEGE
WVDDAPKCGTYHDDTEFRMHDDDLDDNESHNTFQLPELELAHPEQVLSEGVAGIRQDRVR
DRAFHDDEENEDAVDEEPRRSAMTATDLDPGVVVFDEQMLRAIQSEFAALLAEQSAAMAE
SPDKQSTKTRSGCIPCSRLPGLIDVLQLDVSEEQLAELLQEIGATPDTLVSFAECVDILS
LLMESQEAPLLEEDEDEYDDDASNY
Download sequence
Identical sequences jgi|Physo1_1|158731|C_scaffold_134000005 67593.JGI158731

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]