SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 684738.LLKF_0691 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  684738.LLKF_0691
Domain Number - Region: 6-44
Classification Level Classification E-value
Superfamily Zn-finger domain of Sec23/24 0.000102
Family Zn-finger domain of Sec23/24 0.0087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 684738.LLKF_0691
Sequence length 193
Comment (Lactococcus lactis KF147)
Sequence
MKLSKIHCKECGGILNLDIVSHIKNQKLVCPYCQSIYIYEANYSDIGAELEADIERIRLE
EEKENFKEFWKLKKLKEDKKVGFISLLILFSIPLIGFLVMTTNYLIVHRPGQIELPISEK
KLHGENYKNVELKFEDMGFENIKYEKVRDLKLGLFAHSGNVSEVTINGDNDFKKGDNYNK
KSKIKIYYHVFPK
Download sequence
Identical sequences D2BPF7
684738.LLKF_0691 gi|281491173|ref|YP_003353153.1| WP_012897389.1.69015

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]