SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 69014.TK2006 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  69014.TK2006
Domain Number - Region: 59-106
Classification Level Classification E-value
Superfamily Prefoldin 0.0942
Family Prefoldin 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 69014.TK2006
Sequence length 110
Comment (Thermococcus kodakaraensis KOD1)
Sequence
MSEAVNPKLYSIEKLLEDKDKRLLVSEVVLKLAEALGVTVEDFLGYMEWKENMGKLERAE
KEAQIPESIPVEFPTEDAPEGLEEALNEIEEDIQKWQKIERRLKEMGLEL
Download sequence
Identical sequences Q5JIH5
WP_011250956.1.23727 69014.TK2006 gi|57641941|ref|YP_184419.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]