SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 69293.ENSGACP00000000834 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  69293.ENSGACP00000000834
Domain Number 1 Region: 5-263
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.95e-79
Family Calponin-homology domain, CH-domain 0.0000766
Further Details:      
 
Domain Number 2 Region: 1333-1445
Classification Level Classification E-value
Superfamily E set domains 5.19e-36
Family Filamin repeat (rod domain) 0.0000175
Further Details:      
 
Domain Number 3 Region: 1529-1641
Classification Level Classification E-value
Superfamily E set domains 4e-32
Family Filamin repeat (rod domain) 0.00000462
Further Details:      
 
Domain Number 4 Region: 1447-1556
Classification Level Classification E-value
Superfamily E set domains 5.6e-32
Family Filamin repeat (rod domain) 0.0000181
Further Details:      
 
Domain Number 5 Region: 1065-1158
Classification Level Classification E-value
Superfamily E set domains 1.53e-31
Family Filamin repeat (rod domain) 0.00000806
Further Details:      
 
Domain Number 6 Region: 1859-1953
Classification Level Classification E-value
Superfamily E set domains 1.87e-30
Family Filamin repeat (rod domain) 0.00000696
Further Details:      
 
Domain Number 7 Region: 1159-1267
Classification Level Classification E-value
Superfamily E set domains 8.53e-29
Family Filamin repeat (rod domain) 0.0000472
Further Details:      
 
Domain Number 8 Region: 468-574
Classification Level Classification E-value
Superfamily E set domains 9.34e-29
Family Filamin repeat (rod domain) 0.0011
Further Details:      
 
Domain Number 9 Region: 748-872
Classification Level Classification E-value
Superfamily E set domains 1.02e-28
Family Filamin repeat (rod domain) 0.00064
Further Details:      
 
Domain Number 10 Region: 2048-2141
Classification Level Classification E-value
Superfamily E set domains 8.53e-28
Family Filamin repeat (rod domain) 0.0000315
Further Details:      
 
Domain Number 11 Region: 673-781
Classification Level Classification E-value
Superfamily E set domains 8.92e-27
Family Filamin repeat (rod domain) 0.001
Further Details:      
 
Domain Number 12 Region: 2319-2410
Classification Level Classification E-value
Superfamily E set domains 5.14e-26
Family Filamin repeat (rod domain) 0.00000962
Further Details:      
 
Domain Number 13 Region: 2641-2731
Classification Level Classification E-value
Superfamily E set domains 5.8e-26
Family Filamin repeat (rod domain) 0.00000805
Further Details:      
 
Domain Number 14 Region: 565-666
Classification Level Classification E-value
Superfamily E set domains 1.93e-25
Family Filamin repeat (rod domain) 0.0002
Further Details:      
 
Domain Number 15 Region: 861-972
Classification Level Classification E-value
Superfamily E set domains 5.6e-24
Family Filamin repeat (rod domain) 0.0013
Further Details:      
 
Domain Number 16 Region: 2511-2602
Classification Level Classification E-value
Superfamily E set domains 6.14e-24
Family Filamin repeat (rod domain) 0.000016
Further Details:      
 
Domain Number 17 Region: 1630-1743
Classification Level Classification E-value
Superfamily E set domains 1e-23
Family Filamin repeat (rod domain) 0.0000665
Further Details:      
 
Domain Number 18 Region: 1259-1356
Classification Level Classification E-value
Superfamily E set domains 5.39e-23
Family Filamin repeat (rod domain) 0.0000586
Further Details:      
 
Domain Number 19 Region: 279-376
Classification Level Classification E-value
Superfamily E set domains 1.6e-22
Family Filamin repeat (rod domain) 0.0012
Further Details:      
 
Domain Number 20 Region: 380-479
Classification Level Classification E-value
Superfamily E set domains 5.47e-22
Family Filamin repeat (rod domain) 0.001
Further Details:      
 
Domain Number 21 Region: 2418-2509
Classification Level Classification E-value
Superfamily E set domains 1.67e-21
Family Filamin repeat (rod domain) 0.0000156
Further Details:      
 
Domain Number 22 Region: 2253-2334
Classification Level Classification E-value
Superfamily E set domains 9.34e-20
Family Filamin repeat (rod domain) 0.00014
Further Details:      
 
Domain Number 23 Region: 960-1060
Classification Level Classification E-value
Superfamily E set domains 1.8e-17
Family Filamin repeat (rod domain) 0.0012
Further Details:      
 
Domain Number 24 Region: 1961-2044
Classification Level Classification E-value
Superfamily E set domains 6.67e-17
Family Filamin repeat (rod domain) 0.0000663
Further Details:      
 
Domain Number 25 Region: 1795-1875
Classification Level Classification E-value
Superfamily E set domains 2.6e-16
Family Filamin repeat (rod domain) 0.000098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 69293.ENSGACP00000000834
Sequence length 2732
Comment (Gasterosteus aculeatus)
Sequence
MMSNSGYLEPQFFQSCADLGDEEEEEMPATEKDLAEDAPWKKIQQNTFTRWCNEHLKVVN
KRINDLQKDLSDGLKLIGLLEVLSQKKMYRKYHSRPNFRQMKLENVSVALEFLEREHIRL
VSIDSKAIVDGNLKLILGLIWTLILHYSISMPVWEDEDDEDAKKLTPKQRLLGWIQNKMP
QLPITNFHRDWRDGKALGALVDNCAPGLCPDWETWDPSQPVENAREAMQQADDWLGVPQV
IAPEEIVDPNVDEHSVMTYLSQFPKSKLKPGAPLRAKTLHPKRAKAYGPGLEPQGNMVLK
PAEFLVETVEAGLGEVLVYVEDSEGHTEEARVIPNNDQSRSYSVLYLPKVEGLHKVKVLF
AGQNIERSPFTVNVSKAMGDPSRVQARGPGLQLAGNVANKPTYFDIYTAGAGAGDVGVVV
VDSNARRDTVEIVLENKGDSIFRCTYVPVLEGPHTVYVSFARHQIPRSPFTVHISEACNP
NACRATGRGLQPKGLRVKEVADFKVHTKGAGSGELCVSVKGPKGLEEPVKVVEVNNGTFE
CNYYPVLTGKYEVTIAWGGHAVPRSPFEVQVSEEAGSQKVRAWGPGLETGVVGKSADFVV
EAIGTEVGTLGFSIEGPSQAKIECDDKGDGSCDVRYWPTEAGDYAVHVICDDEDIKDSPF
MACVLPAASDLLPEKVRCYGPGLEPFGCIVNKPVDFTIDTRGAGRGELKLYAQDAEGFPI
NVQITEKGDSSFFCVYVPTKPIKHTVIITWGDINAPSSPFRVMIGEGSHPEKVKVYGPGV
EKTGLKANEPTYFTVDCSEAGQGDVSIGIKCAPGVVGPVEADIDFDIIKNDNDTFTVKYT
PPGPGQYTIMVLFADQEIPISPFRIKVDPSHDAAKVTAEGPGLLRTGVEVGKPTHFTIYT
KGAGKAKPKVCFTRAAKGEAVRDFEIIDNHDYSYTVRYTAVQQGITSVTVCHGGDPIPKS
PFDISVAPPLDLSRVKVQGLNNKVDVGKDEEFTIVTRDVGGQGRLEVKITSPSQQAIPCK
LEPSLAGEVHTVNYILLEEGQYRVDISYDENPVPGSPFSVEGIMPPDPSKVRAYGPGLQG
GVVGKPAHFAIDTKGAGTGGLGLTVEGPCEAKIECQDNGDGSCSVSYLPTEPGEYAINIL
FADRHVPGSPFKAAVQSAFDPSKVTASGPGLERGKVYEDGCFTVDCTEAGSAELTVEIIS
DSGAEAEVHVQNNNDGTYSVTYIPQVHGMYTVTVKYGGLTVHKFPARLQVDPAVDTSGVK
VHGPGVEPRGVLREVTTHFLVDARAHHKSGGSRVKAAISNPSGINTDAYVTDKGDGTYRV
EYTPYEDGPHLIEILFDDVSVPKSPFRVLVAEGCDPSRVRAYGQGLEEGLVNKPNRFTVE
TRGAGTGGLGLAIEGPSEAKMSCKDNKDGSCSVEYIPFTPGDYDVNITFGGLPIPGSPFR
VPVRELVDPSKVKCTGPGLGSGVRAHVPQTFTVDCSRAGVAPLEVQLYGPTGVTEPISIT
DSRDGTHTVTYTPAEDGPYTLCVKYADQEVPRSPFKIKTLPAHDASKVRASGPGLNTLGV
PASLPVEFTIDARDAGEGLLTVQILDPEGKPKKANIRDNWDGTYTVSYVPDTAGRYTITI
KYGGDEIPYSPYRIHAAPSGDASKCLVTVSIGGHGLGSVMGPSIQIGEETVITVDAKAAG
KGKVTCKVSTPDGAELDVNVVENADGTFDIYYTAPEPGKYVITIRFGGENIPNSPFHLVA
TDTVPIIEAPCEQLQLHQPLTPYTGCSPPWATDDPISPVDVMKPVLRPFSLVIPFTVQKG
EITGEVRMPSGRNACPHITDNKDGTVTVNFSPTERGLHKMDIRYDGNHIPGSPLQFYVDA
INSGHVTAYGPGLSHGTVNQPATFTIVTKDAGEGGLSLAVEGPSKAEISCKDNKDGTCTV
SYLPSVTGDYNIIVKFDDKHIPGSPFTARITGAGTTGDESVRMSQLNVGTSTDVSLKITE
TDLSSLTASIRAPSGYEEPCLLKRLPNRHIGISFTPKEVGEHVVSVKKTGHHVTNSPFKI
MVGQSEIGDAGKVKVLGQGLIEGHIFEVAEFIVDTRHAGSGGLGLSIEGPSKVDIICEDV
EDGTCKVTYCPTEPGNYIINIKFADQHVPGSPFTVKVFGEGRMKESITRRRQAPSIAKVG
STCNLNLKIPGNWFHMVSAQECLTRTFTRSSHTYTRTERTEISKTRAGETKREVRVEEST
QVGDPFRDVFGNFMGRDSLSGFNPFPSSPLGDSGNQEMTAQVTSPGGQQDEAEIIKGEDS
TYSVRFVPQEMGAHTVNVKYRDQHVPGSPFQFTVGPLGEGGAHKVRAGGTGLDRGVAGIL
AEFSIWTREAGAGGLSIAVEGPSKAEITFEDRKDGSCGVTYVVQEPGDYEVSIKFNDDHI
PDSPFLVPVAALSDDARRLTVSSLQEMGLTVGKEASFAVQLNGARGLIDAKIHTPSGATE
ECYITELETDQHAIRFVPRENGVHSIDVRFNGSHVPGSPFKIRVGEPGQAGDPGMVLAFG
PGLEGGTTGGTSEFTVNTCSAGSGTLSVTIDGPSKVKMDCQESTEGYRVSYMPMAPGNYL
ISIKYGGPRHVVGSPFKAKVSGPRLSAGDSLHETSSVLVETLSKTMAMGGALSSLPRFSS
DASKVVSRGSGLSKAFVGQKNTFTVDCSRAGINMLMVGVHGPKTPCEEVYVKHMGNRTYN
VTYTVKEQGSYILIVKWGDENVPGSPFHFTVP
Download sequence
Identical sequences G3N6A9
69293.ENSGACP00000000834 ENSGACP00000000834 ENSGACP00000000834

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]