SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 69293.ENSGACP00000000865 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  69293.ENSGACP00000000865
Domain Number 1 Region: 389-624
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 6.67e-35
Family Calponin-homology domain, CH-domain 0.00012
Further Details:      
 
Domain Number 2 Region: 91-239
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.00000000000000382
Family FAD/NAD-linked reductases, N-terminal and central domains 0.083
Further Details:      
 
Domain Number 3 Region: 787-815
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000919
Family LIM domain 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 69293.ENSGACP00000000865
Sequence length 849
Comment (Gasterosteus aculeatus)
Sequence
MGDESYPQCGAQKLFDAFVTASTCRVALGSFNQLCDHLALDRGAAERPLYRPIKRRLNYW
RANALWAKLDRRANQQEYRKGDRVCSNTTCVIIGAGPCGLRTAVELSFMGARVVVVEKRD
SFSRNNVLHLWPFTIHDLRGLGAKKFYGKFCAGSIDHISIRQLQLVLLKVALLLGVEVHV
NVEFKNLLEPAEDQQGCKLGWRMEVSPKSHAVNQLEFDVVIGADGRRNALPGFRRKEFRG
KLAIAITANFKNRHTSAEAKVEEISGVAFIFNQRFFQELRQETGIDLENIVYYKDDTHYF
VMTAKKHSLLEKRVIKQDFAETELLLSRANVDQNALQAYAREAANFSTNHQLPSLDFAMN
HCGQPDVAMFDFTCMYASENAAMVRQRQGHQLLVTLVGDSLLEPFWPMGTGIARGFLAAL
DSAWMIQRWSQGEAPLDILADRESLYRVLPQTTQENLQKNISLFTVDPTTRYLNINLMLI
TPAQVRHLVDTGEETGLNTDRGEINHLPSPRFFEQSSFSESNKLLIWCQEHTRGYRGVAV
SDLTTSWKNGLALCALIHRYRPDLIDFNSLDPSSVEDNTRLSFDVAERHFGIPPLMWVDE
MNSVEEPDSLSMVMYLSQFYQLLRDKLPPAGRISDLAHIADLKSALLTPASLLSRLGLSP
SRKRNPKVLPEEQSDAVSKRRRTSRESRESCDLTGNDVNEVCDRAVVGGSNCCRVRLMAN
QLQAKLDERSSSSSDAAALRRQRLLDTSRGQRRPPDFPCLLTPAPSHPSVGSQPPHLPLC
LQSSGCRCVCFFCQKRVYLMERLSAESLFFHRSCFQCSSCSEGLRLSTYAFDPLLRRFYC
LQHFNSRLS
Download sequence
Identical sequences G3N6E0
ENSGACP00000000865 ENSGACP00000000865 69293.ENSGACP00000000865

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]