SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 69293.ENSGACP00000001123 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  69293.ENSGACP00000001123
Domain Number 1 Region: 41-242
Classification Level Classification E-value
Superfamily L domain-like 2.93e-38
Family Ngr ectodomain-like 0.031
Further Details:      
 
Domain Number 2 Region: 526-635
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 3.93e-22
Family Calponin-homology domain, CH-domain 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 69293.ENSGACP00000001123
Sequence length 680
Comment (Gasterosteus aculeatus)
Sequence
KRGGRAERLMAAGDGAQLPATVAASRSVDKGLEEAAASGALNLSNRKLKEFPRSARNYDL
SDITHADLSKNRLCELPEELCQFISLETLSLYHNGMRSLSSSLGNLQALTYLNLSRNLLS
GLPPSVFQLPLLRVLVVSNNKLCSLPASIFSLTHLRQLDLSCNELQCLPAELGQLECLRD
LNLRRNQLTTLPEEISELPLVRLDVSCNRISHVPLCYRHLRHLQSILLDNNPLQMPPAQI
CSKGKYHIFKYLNMEACKRSQEELERHLRPTGFKNWFPCSLSDHELFGGLDSGFNSVDSG
SKRWSGNESADDFSERSLRMAEVSRDQRNPEEANKVNGDAVHVDFIHSSVTKREDEDVGM
DAAPLLVPVFLGLVRSPSQDLLRNSPNLEERRRPGTLLIWQERERLQQQREKASGASPEN
SSSPPGLRQRLALFRVLQLSVIHGSSLPVGASICQPCDSLGTCPGCCPILKSPDVPSSPK
TSPPPGQAQRPNSFLFRTSSRSNVKPTGSALGECGRSESRTMLRSPKEERPDITQLRKTL
ESRLKITLPEDLGEALSNGTVLCQLVNQIRARSVSLIHIPSPAVPKLSSSKCRLNVENFI
AACRKLGVTETDVCASSDVLLCKLPAVLRCVTALLAARGGETGEEGSPRHSSSSSLLSAD
FLLFYSAAMILLYILYSYLL
Download sequence
Identical sequences G3N747
ENSGACP00000001123 ENSGACP00000001123 69293.ENSGACP00000001123

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]