SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 69293.ENSGACP00000001341 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  69293.ENSGACP00000001341
Domain Number 1 Region: 8-79
Classification Level Classification E-value
Superfamily RING/U-box 7.69e-21
Family RING finger domain, C3HC4 0.0066
Further Details:      
 
Domain Number 2 Region: 142-207
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 7.78e-19
Family B-box zinc-binding domain 0.00044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 69293.ENSGACP00000001341
Sequence length 245
Comment (Gasterosteus aculeatus)
Sequence
MASANYGPSEDQFLCSICLDVFTDPVTTPCGHNFCINCINEHWNTSDQNLCPTCKKDFIT
RPDLRVNTFISEMVVQFRQSAQQKASSSSSEQQEYKPGEVPCDVCTGTKVKALKSCLVCL
VSYCETHLEPHLTMSGLKRHQLMDPVENLEGRMCTKHDKPLELFCKSDQTCVCMLCTVLD
HKNHEYVPLKEEYEEKKVELKKTEAEIQQMIQKRRLKIQEIKHSVDLSEEDAGRAKAEVF
TSSLI
Download sequence
Identical sequences G3N7Q8
ENSGACP00000001341 69293.ENSGACP00000001341 ENSGACP00000001341

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]