SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 69293.ENSGACP00000004962 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  69293.ENSGACP00000004962
Domain Number 1 Region: 21-252
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 5.43e-76
Family Calponin-homology domain, CH-domain 0.0000809
Further Details:      
 
Domain Number 2 Region: 1317-1431
Classification Level Classification E-value
Superfamily E set domains 5.74e-37
Family Filamin repeat (rod domain) 0.0000113
Further Details:      
 
Domain Number 3 Region: 1048-1138
Classification Level Classification E-value
Superfamily E set domains 4.2e-31
Family Filamin repeat (rod domain) 0.00000577
Further Details:      
 
Domain Number 4 Region: 1419-1525
Classification Level Classification E-value
Superfamily E set domains 6.34e-31
Family Filamin repeat (rod domain) 0.0000293
Further Details:      
 
Domain Number 5 Region: 1513-1619
Classification Level Classification E-value
Superfamily E set domains 1.2e-30
Family Filamin repeat (rod domain) 0.0000287
Further Details:      
 
Domain Number 6 Region: 1602-1717
Classification Level Classification E-value
Superfamily E set domains 5.2e-29
Family Filamin repeat (rod domain) 0.0000284
Further Details:      
 
Domain Number 7 Region: 1226-1337
Classification Level Classification E-value
Superfamily E set domains 5.54e-29
Family Filamin repeat (rod domain) 0.00000836
Further Details:      
 
Domain Number 8 Region: 445-561
Classification Level Classification E-value
Superfamily E set domains 4.54e-28
Family Filamin repeat (rod domain) 0.001
Further Details:      
 
Domain Number 9 Region: 354-464
Classification Level Classification E-value
Superfamily E set domains 8.67e-28
Family Filamin repeat (rod domain) 0.00063
Further Details:      
 
Domain Number 10 Region: 1794-1895
Classification Level Classification E-value
Superfamily E set domains 1.4e-27
Family Filamin repeat (rod domain) 0.0000252
Further Details:      
 
Domain Number 11 Region: 552-654
Classification Level Classification E-value
Superfamily E set domains 2.74e-27
Family Filamin repeat (rod domain) 0.0000941
Further Details:      
 
Domain Number 12 Region: 1141-1250
Classification Level Classification E-value
Superfamily E set domains 8.67e-27
Family Filamin repeat (rod domain) 0.0000276
Further Details:      
 
Domain Number 13 Region: 2250-2342
Classification Level Classification E-value
Superfamily E set domains 1.13e-26
Family Filamin repeat (rod domain) 0.000012
Further Details:      
 
Domain Number 14 Region: 1985-2077
Classification Level Classification E-value
Superfamily E set domains 2.67e-26
Family Filamin repeat (rod domain) 0.0000262
Further Details:      
 
Domain Number 15 Region: 657-756
Classification Level Classification E-value
Superfamily E set domains 4.4e-26
Family Filamin repeat (rod domain) 0.00032
Further Details:      
 
Domain Number 16 Region: 838-953
Classification Level Classification E-value
Superfamily E set domains 1e-24
Family Filamin repeat (rod domain) 0.00068
Further Details:      
 
Domain Number 17 Region: 742-858
Classification Level Classification E-value
Superfamily E set domains 1.07e-24
Family Filamin repeat (rod domain) 0.001
Further Details:      
 
Domain Number 18 Region: 267-363
Classification Level Classification E-value
Superfamily E set domains 3.94e-24
Family Filamin repeat (rod domain) 0.001
Further Details:      
 
Domain Number 19 Region: 2344-2438
Classification Level Classification E-value
Superfamily E set domains 1.4e-23
Family Filamin repeat (rod domain) 0.0000206
Further Details:      
 
Domain Number 20 Region: 2441-2532
Classification Level Classification E-value
Superfamily E set domains 2.47e-23
Family Filamin repeat (rod domain) 0.0000186
Further Details:      
 
Domain Number 21 Region: 2568-2658
Classification Level Classification E-value
Superfamily E set domains 2.6e-23
Family Filamin repeat (rod domain) 0.0000185
Further Details:      
 
Domain Number 22 Region: 965-1062
Classification Level Classification E-value
Superfamily E set domains 4.6e-21
Family Filamin repeat (rod domain) 0.0019
Further Details:      
 
Domain Number 23 Region: 2184-2263
Classification Level Classification E-value
Superfamily E set domains 3.94e-19
Family Filamin repeat (rod domain) 0.00018
Further Details:      
 
Domain Number 24 Region: 1900-1981
Classification Level Classification E-value
Superfamily E set domains 1e-17
Family Filamin repeat (rod domain) 0.0000318
Further Details:      
 
Domain Number 25 Region: 1737-1815
Classification Level Classification E-value
Superfamily E set domains 0.0000000000000934
Family Filamin repeat (rod domain) 0.00016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 69293.ENSGACP00000004962
Sequence length 2659
Comment (Gasterosteus aculeatus)
Sequence
MKKQGKRERDNPKKSKMPVTEKDLAEDAPWKKIQQNTFTRWINEHLKCVNKRIADLQLDL
GDGLRLIALLEVLSHKKMFRKYHPRPNFRQMKLENVSVALEFLDMENIKLVSIDSKAIVD
GNLKLILGLVWTLILHYSISMPIWEGEDEKPESKTPKQRLLGWIQHKLPDVPINNFSQDW
RNGRALGALVDSCAPGLCPDWETWDPVKPVQNATEAMQLADDWLGIPQVMAPEEIIDPSA
DEQSVMTYLSQFPKAKLKPGAPLKPKLNPKKARAYGPGIEPTGNRVLRPAVFTVDTFSAG
QGQVTIYLDHPDGTREELKAEPNEGKKTFSVSYVPKVVGLHQVTVMFAGQQIPKSPFEVT
VDKALGDASKVMVKGPGIEPVGVVANNPTYFDIYTAGAGTGDVTAVIRDPQGRQNAVEAM
MEDKGDSTYRCTYRPSQAGPHTVAVTFGGAGIPRSPFPVDVGPACAPGACRATGRGLQPS
GMRVKQVGDFKVDTRNAGSGELKVLVKGPKGVEEPVKQISAQDAVFSYEYHPSSAGKHTV
SITWGGQHIPKSPFEVAVGREAGPQQIRAWGPGLEGGIVGKPATFVVESVGTDVGVLGFA
IEGPSQAKIECEDKNDGSCDVRYWPTEPGEYAVHVTCDEEDIEHSPFMAHIVADSGSSDA
EKVQAFGPGLEKTGCLLNQPAEFTVSAKDAGKGPLKITAQDAEGLPVEVKARSKGDGLYS
CSYTPASPLKHTLSVAWGGVGVPNSPFRVNVGKGSHPKMVKVFGPGVERTGLKANEPTHF
TVDCSGAGDGDVSVGIKCAANMVGDQEADVDFDIIPNANDTFTVKYMPPAAGNLTVKVLF
TDKEVPQSPFNIKVEPSHDASKVKAEGPGVARTGVEAGKPTHFTVLTKGAGKAPLDVSFS
SPVSDFDIIDNYDYSQTVKYTPVQQGEQSVTVKFGGDAISKSPFKVGVAAPLDLSKVIVD
DLEGRAEVDQEQQFVVDTKGAGGQGRLEVTVLSPSQRALKVKTEPEASRAGVSRVRYTPT
EEGVHAVNVSYDGHPVPGSPFPVEAQLPPDPSKVKAFGPGLKGGLVGNPAEFTIDTKGAG
TGGLGLTVEGPTEAKIECSDNGDGTCSVSYLPTEPGDYLVNILFEEVHIPGSPFKADVQM
PFDPSKVVASGSGLKRAKVGETSVVNVDCSRAGPGQLSLEAVPDSCAKAKTEVVDNKDGT
YTVTYVPLTAGMYTLLLKYGGKAVPGFPTKVAVDPAVDTSKVKVFGPGVEGQDVFREATT
SFTVDARPLTRRGGDHVRAEVKNPSGALTDCQITDNATGIYNVDYTPFENGVHSVQVLYD
DTPVPQSPFRVAVAEGCDPSRVVATGPGLQQALTEQPNHFNIVTRGAGIGGLGITVEGPS
ESKMSCKDNKDGSCSVEYVPLTPGPYEVNITYGGEHIPGSPFKVPVKDAVDSSKVKVSGP
GVGSGVRANVPQSFTVDCRKAGVAPLAVAVAALKGAAEPVEVTDNGDGTHLVSYTPSVEG
PYSVAVKYGEEDVPRSPFKFRVLPTHDASKVRASGPGLTTGVPASFPVEFHIDAKDAGQG
QLSVLITDQDGKPRQPGIHDNGDGTYRVSYVPDRAGRYTIVVKYGGDDIPASPYRVRATA
TGDASKCTVTGPGVGPTVTIGEELGLVVNAKGAGKGKVSCVVVQPDGSEVEAEVLENEDG
TFDIFYTAPAPGNYVIYVRFGGENVPRSPFKVMATDEPIGSVNGSGFRPFDMVIPFSFTK
GEITGEVLMPSGKSAQPVISDNLDGTVTVQYSPTEAGLHEMHIKYNGTHIPGESPLQFYV
NHASSPNVTAYGPGLSYGVANRAATFTVFTEDASEGGLDLAIEGPSKADINCVDNKDGTC
SVSYMPTLPGDYNILVKYNDKHIAGSPFSARIIGQDNQRRSQVKLGSAADFSLDISETDL
SVLTASIVSPSGRDEPCLLKRMANNHIGISFIPREVGEHRVSILKNGRHVANSPITIMVV
QSEIGDASQVKVGGDGLVRGTTFSNSSFVVDTRDAGYGGLALSIEGPSKVDIQTEDVEDG
TCRVTYCPTEPGNYIVSIRFAEEHVPGSPFTVRVTGEGRIRESVTRRQKAASVSSVGSVC
DLSLKIPAGSWFLLVLSRQLLSRASFRSCCSLRWSGRPVGRRLCSAAVAGDRSLSPGRVR
LVSGLSGVVLAGGSRAARGVWVVEAQEVTAEVTSPSGARQPAELVAAGNDTYCVRFVPTE
MGVHSVSVRYRGAHVPGSPFQFTVGPLGEGGAAKVTAGGPGLEGAQAGEPAEFSIWTREA
GAGGLSIAVEGPSRAEISFDDRKDGSCGVSYVAQDPGDYEISVKFNEQHIPDSPYLVPVV
APANDARRLTVTGLQESGLKANHPASFAVRLNGAQGKLEAKVHSPSGALEECVVTELEQD
KYAIRFIPRENGVHTIDVKFNRSHIPGSPFQVRVGKPGQTGEPGLVSAYGAGLERGTTGS
QSEFTINNTKAGPGALAVTIEGPSKVKMDCREVPEGYKVQYTPMAPGNYLISIKYGGPNH
IGGSPFKAKVTGSRLVSVTNGSETSTLTLDPAARASSQSAAPWASDSDASKVSSRGPGLS
KAFVGQRSNFSIDCSKAGKNMLLVGVLGPQTPCEEVLVKHLGNLQYNVSYMLKERGNYIL
VVKWGEEHIPGSPFQVSVP
Download sequence
Identical sequences G3NI02
ENSGACP00000004962 ENSGACP00000004962 69293.ENSGACP00000004962

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]