SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 69293.ENSGACP00000006183 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  69293.ENSGACP00000006183
Domain Number 1 Region: 32-225
Classification Level Classification E-value
Superfamily L domain-like 3.74e-36
Family Ngr ectodomain-like 0.0022
Further Details:      
 
Domain Number 2 Region: 242-340
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000683
Family I set domains 0.044
Further Details:      
 
Weak hits

Sequence:  69293.ENSGACP00000006183
Domain Number - Region: 492-524
Classification Level Classification E-value
Superfamily Fibronectin type III 0.021
Family Fibronectin type III 0.0081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 69293.ENSGACP00000006183
Sequence length 686
Comment (Gasterosteus aculeatus)
Sequence
LLQLLALWTTVVGNVQCCPELCSCQDKHTHQIADCAYKELQEVPEGLPSNVTTVSLSANK
IKLLKSKSFIDITQVSSLWLAHNEIVTIETDTLAPLIQLRNLDISYNKIVDFPWEDLRNL
TGLQLLRMNNNEMVNLPKDAFTNLKDLRSLRINHNKFTVIEQGTFSALSSMSHLQIFDNP
FTCSCNLEWLRDWITTTKISVPSPNLITCEAPEHLKGTMVTLIPKLDCVAPTVKISSEPN
VENTEISEGLMVILNCETTGSPTPQISWEVTAGNQNFLFPLPSTGEMNDVPINDKTTNGR
FLVFRNGSLIVPRMSKREDGDYSCSAGNDLGRAESSVKLAMAVTQKHGIDSKPDSTLEKI
RPSVKKPAEAGSSINNVINWTKPDGKPKGGPEGPFDKSAGTGQVVKEHTFASKCGVRESS
EYISNHAFNLSLEDLKQYTFDSGVIALEVSETEAKVQLNPLQLPSSKSNLHSSSSKVTLN
MLYLCVNTGNGHSMVQWSNIEEGVNAYRFHGLHPGTNYTLCLTHGGQDCQVQVVFTTRKK
IPSLLIIVVVSIFLLGLATVPLFGATCCHLLYKYQGKTYKLIMKAQNPDQMEKQATEDFD
PRASFVESEKTFDPSELGEGEGEADGEEGDGEADGSVVTESIPGSSSKTNPEEFEVGSEY
SDKLPLGAEAVNISEEINGNYKQPSR
Download sequence
Identical sequences G3NLH0
ENSGACP00000006183 ENSGACP00000006183 69293.ENSGACP00000006183

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]