SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 69293.ENSGACP00000007197 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  69293.ENSGACP00000007197
Domain Number 1 Region: 3990-4224
Classification Level Classification E-value
Superfamily Plakin repeat 4.27e-86
Family Plakin repeat 0.000000027
Further Details:      
 
Domain Number 2 Region: 175-403
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 3.62e-84
Family Calponin-homology domain, CH-domain 0.00000104
Further Details:      
 
Domain Number 3 Region: 3086-3326
Classification Level Classification E-value
Superfamily Plakin repeat 8.24e-81
Family Plakin repeat 0.000000213
Further Details:      
 
Domain Number 4 Region: 3418-3657
Classification Level Classification E-value
Superfamily Plakin repeat 1.12e-79
Family Plakin repeat 0.000000235
Further Details:      
 
Domain Number 5 Region: 2761-3000
Classification Level Classification E-value
Superfamily Plakin repeat 5.36e-78
Family Plakin repeat 0.000000368
Further Details:      
 
Domain Number 6 Region: 3753-3976
Classification Level Classification E-value
Superfamily Plakin repeat 6.41e-70
Family Plakin repeat 0.000000873
Further Details:      
 
Domain Number 7 Region: 4300-4341,4381-4576
Classification Level Classification E-value
Superfamily Plakin repeat 1.22e-65
Family Plakin repeat 0.000000334
Further Details:      
 
Domain Number 8 Region: 418-534
Classification Level Classification E-value
Superfamily Spectrin repeat 7.34e-23
Family Spectrin repeat 0.0048
Further Details:      
 
Domain Number 9 Region: 1294-1474
Classification Level Classification E-value
Superfamily Spectrin repeat 4.07e-17
Family Spectrin repeat 0.015
Further Details:      
 
Domain Number 10 Region: 755-857
Classification Level Classification E-value
Superfamily Spectrin repeat 6.24e-16
Family Spectrin repeat 0.0055
Further Details:      
 
Domain Number 11 Region: 662-753
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000314
Family Spectrin repeat 0.0047
Further Details:      
 
Domain Number 12 Region: 4248-4295
Classification Level Classification E-value
Superfamily Plakin repeat 0.000000000575
Family Plakin repeat 0.0096
Further Details:      
 
Weak hits

Sequence:  69293.ENSGACP00000007197
Domain Number - Region: 862-944
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00448
Family Spectrin repeat 0.012
Further Details:      
 
Domain Number - Region: 936-992
Classification Level Classification E-value
Superfamily SH3-domain 0.022
Family SH3-domain 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 69293.ENSGACP00000007197
Sequence length 4640
Comment (Gasterosteus aculeatus)
Sequence
MVAGMLMPLRELRAIYELLFKDGVMVAKKDKRPQIKHPELECVSNLQVIRAMGSLKSRGY
VKETFAWRHFYWYLTNEGIVYLRDYLRLPAEIVPASLQRTRKPLAIGHRVPRVQSVEGPT
SYVPKPGRWGEAESQEAMTERQGYRHKMMVPGEKERSVVFLSTATLAALPHPGEAGRSAR
DERDRVQKKTFTKWVNKHLIKSQRHVTDLYEDLRDGHNLISLLEVLSGDTLPREKGRMRF
HKLQNVQIALDFLRHRQVKLVNIRNDDIADGNPKLTLGLIWTIILHFQQISDIQINGQSE
DMTAKEKLLIWSQRMTNGYQGIRCDNFTTSWRDGKLFNAVIHKHHPRLIDMGQVYRQTNL
QNLEHAFHVAESDLGVTRLLDPEDVDVPHPDEKSIITYVSSLYDAMPRLDAHDGARANEL
ELRWQEYYELVTLLLQWNRHHVTIFQERKFPASYEEIEILWRQFLKFKETELPAKESDKN
RSKHIYQSFESAVHAGQVKVPPGYHPIDVEKEWGRLHVAILERERLLRIEFERLERLQRI
FSKVQMESGTYDGQLSHLETLLQTDIRLLKAGKPAQHTAEVERELDKADNAIRLLFNDVQ
ILKDGRHPQAEQMYRRVYCLHERLVNLRTDYNLRLKSSMKITQVPQTQSVRPEQDDVTIR
YVKDLLAWVEENQLRIDGAEWGSDLPSVESQLGSHRGLHKTVEDFRSKIERARADESQLS
PIGKGSYREYMGKLDLQYGKLLNSSKSRLKNLDSLHTFIGAATKEMMWLNDKEEEEVNFD
WSDRNANMTAKKDNYSGLMRELELREKKVSDLQVMGDRLVRDGHPGKKTVESFTAALQTQ
WSWILQLCCCIEAHLKENTAYYQFFADVKEAQDKMNKMQENMKKKYSCDRSTTATRLEDL
LQDTVEEKEQLNEFKTIATGLNKRAKSIIQLKPRNPTTPIKGKLPVQAVCDFKQQEITVH
KGDECALLNNSQPFKWKVLNHSGHEAVVPSVCFMVPPVNKEAVDSVSSLDSGYQQMVSMW
QTLHIDMKSLLSWQYLMKDFTQIHSWNITTLKTMKSEEYRLIMRNLELHYQDYMRESQDS
QLFGPSDRMQVEEDYSKSTQHFDHLIRSMEKGQQDETLCKNYISEIKDLRVIIEACEAGT
VARIRKPMETEPLKECAEKTADQQKVEAKLKSLKKDLDKVSSRTQEVLASPQQSVSAPVL
RSELELTVQKMDHASVLSSVYLEKLKTVEMVIRNTQGAEGVLKQYENILREVHTVPSDCK
EVETYRKMLKTMREEAEGEQPVFDCLEEELKKAKAVSDKMSRVHSERDVELDHYRQLLSG
LQERWKAVFAQTDVRQRELEQLGRQLGYYRESYDWLIHWIADAKQRQDKIQAVLITDSKT
LNEQLSQEKKLLEEIESNQGKVDECQKYAKAYINTIKDYELQVVAYQAQVDPLASPLKKS
KMDSASDNIIQEYVTLRTRYSELMTLTSQYIKFITDSQRRLEDEEKAAKKLKAEEQKKMA
EMQAELDKQKQLAAAHAKAIAEAEKEAQELKLRMQEEVSRREIAAVDAEKQKHNIQLELH
ELKNLSEQQIKSKSQQVDEALHSRTKIEEEIHLIRIQLETTVKQKSSAESELNQLRERAA
EAERLRKVAQEEAEKLHRQVNEETQKKRAAEEELKRKSEAEKEAAKQKQKALEDLENLKM
QAEEAERQVKQAEIEKERQIKVAHVAAQKSAAAELQSKQTSFVEKTSKLEESLKQEHGAV
LQLQQQAAQLKKQQEDAVNAREEAEKELEKWRQKANEALRLRLQAEEEAHKKSLAQEDAE
KQKEEAEREARKRTKAEESALKQKDMAEKELERQRKVAESTAQQKLTAEHELIRLRADFD
NAEQQRSLLEDELYRLKNEVVAAQQQRKQLEDELAKVRSEMDILIQLKSKAEKETMSNTE
KSKQLLEAEASKMRDVAEEASKLRAIAEEAKHQRQVAEEEAARQRAEAERILKEKLAAIS
DATRSKTEAEIALKEKEAENERLRRQAEDEAYQRKALEDQASQHKQEIEEKIVQLKKSSE
VEMERQKAIVDDTLKQRRVVEEEIRILKLNFEKASSGKLDLELELNKLKNIAEETQQSKL
RTEEEAEKLRKLALKKITAAEEEAARQCKAAQEELARLKKKAEEARRQKELADIEAEKQV
VAAEQASLKCSAAEQQAQSVLAQQKEDSIMQKTLREEFKKAQKLAKEAEAAKEKAEKEAA
LLRQQAEEAERQKVAAEQEAAIQAKAQEDAERLRKEAEFEAAKRAQAETSALKQKQQADA
EMAKHKKLAEQTLKQKFQVEQELTKVKLKLDDTDKQKSVLDEELQRLKDEVDDAVKQRGQ
VEEELFKVKVQMEELLKLKLRIEDENQRLIKKDKDNTQKFLAEEAEIMKRLAEDAARLSV
ESQEAARLRQIAEEDLSQQRVLAEKMLKEKMQAIQEASRLRAEAEMLQRQKDLAQEQAQK
LLEDKQLMQQRLQDETQEYQKSLEAERKRQLEIVAESEKLKLQVSRLSEAQAKAEEEAKK
FKKQADSIAARLQRTEIDTQEKMTSMEKLELEKLHTSKEANDLHQAIAGLEMEKARLKKE
AEELQNKSKEMADAQQKQIEHEKTVLQQTFLTEKEMLLKKEKLIEDEKKRLESQFEEEVK
KAKALKDEQERQRKLMEEEKNELHINMTMALSKQKEAEKDMLNQQKEMQELEKKRLEQER
ILEEENQKLRNKLKQLEEAQTDKFPEKHLISVTTVTTTVPNGQNAGDAVDNVEKRPDPLA
FDGIRDKVPASRLRQVGLLSKKEFEQLQKGKKTVQELGETDKLKTALRGKNCIAGILTPS
DQKMSIYQASKEKKITPGTAMILLEAQAATGYILDPIKNQKLSVNEAVKEDLIGPELHNK
MLSAERAVIGYKDPYTGGKISVFEAMKKGLIERDHALRVLEAQLATGGIVDPNNSHRVPK
EIAYEQGQFDREMNTIMEKPLDDAKGYFDPSTQEPLTYSELMARCKTDPDTNLLLLPITD
KAAHCSSIYTEEETKDVFSKTTVSVPFGQFKGKTVTIWEIINSEYFTEDQKKDLLRQYKT
GKITIEKIIKIVITVVEEKEKKNEITFDGLRAPVPATELLESQIIDKDLYNKLHKGNKTV
KEVSEIEPVRKALKGTNCIAGVVIDSSKETMSFYQAMKKEMMRTGLALNMLEAQAGTGYV
VDPVNNKKHTVDEAVKAGVVGPELHEKLLSAERAVTGYKDPYTGKTVSLFQAMKKDLIPK
EQGIRLLDAQMTTGGIIDPVKSYYIPHEVACKRNYFDDEMKQMLNSPTDETKCFFDPNTR
ENVTYSQLFKRCVTDKKTGLQLLPLSKEAINAKEEPTYTDAQTKEAMTQATVELDSGPFK
GRKMTIWEIINSEYLTEEQRLELLRQFRSGKITIEKIITIIITIVDEKEDKKREQSSFKG
LRAPVPAASLYDSKIIDKPTFDLLQQGKTTPKQVSENPDVNKYLQGSDSIAGIYLEPTKE
KVSIYQAMKKKLLRHNTGLSLLEAQAATGFLVDPVRNQCLTVDEAVKSGLVGPELHEKLL
SAEKAVTGYKDPFTGKKISLFEAVQKDLLLKEHALPLMEAQMVSGGIIDPVKSHRVPTDV
AYQKNIFSKEMAKTLSEPSDDNKAFLYPETDEKVTYRQLRDKCRRDPETGLFILPLSKPQ
SPTVVEKTYLYTEEQTESDLNDTQIDIPIEGFADKPVNLWEIMNSNLLPEQERQKLLDEY
RSGKITKERMIIIIIEIMEQREIVRNDPFSCKTIRRRITIEELYNARIIDLETYNLLKKG
KRDIRDIMEMTTVKQYLYGTGCVAGVTTDSNSKISLYQAMKQDFIKPELALSLLEAQAAT
GFIIDPVKNETLTVDEAVRKGVVGPELHDKLLSAERAVTGYKDPYSGKIISLFQAMKKDL
VLEDYALKMLEAQNATGGIIDPEFQFHLPTDIAMQRGYINKETNEKLTETVKGFIDPVND
ENLSYAELLKRCKLRDGLRLLSLGDKRVMFQGLRKKITMEELLRSKIIDQQTVTELNEGR
ISVEEVSNRLSRYLEGTSCIAGVFLESTKDRLSIYQAMKKNMIRPGTAFELLEAQASTGY
VIDPIKNLKLTVNDAVKMGIVGPEFKDKLLSAERAVTGYRDPYSGKTISLFQAMKKGLIL
KDHGIRLLEAQIATGGIIDPEESHRLPVEVAYNRGFFDEEMNEILTDPSDDTKGFFDPNT
EENLTYLQLMERCITDPDTGLVLLLLKEKKRETKTSSKSSVRKRRIVIVDPETGKEMTVY
EAYRKGLIDNQTYLELAEQECEWEEITMTSSDGTVKSLIIDRRSGRQYDVDDALSRGLID
QNSLDTYRSGNLSITEFADMLCGNAGGFRSRTSSFGSTTGSTYSSPMSPIPSIKPPAVIW
NDPAEETGPIAGILDIDTLEKVSITEAIHRNLIDNISGQRLLEAQACTGGIIDPTTGEKF
SLTDATEKGLLDKIMVDRLNLAQKAFNGFEDPRTKVKMSASQALKKGWLYYEAGQRFLEV
QYLTGGLIEPDVESRVTLDESIRKGTIDARTAQKLRDVGAYSKYLTCPKTKLKISFKDAM
DKSMVEEESGLRLLEASSQSSKGLYSPYNASQPGSAYGSRTGSRTGSRSGSRRGSIDAGF
GLSISSSSFSSSSTGYTRRF
Download sequence
Identical sequences G3NPD3
ENSGACP00000007197 ENSGACP00000007197 69293.ENSGACP00000007197

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]