SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 69293.ENSGACP00000007628 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  69293.ENSGACP00000007628
Domain Number 1 Region: 39-165
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 2.22e-47
Family Regulator of G-protein signaling, RGS 0.00000935
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 69293.ENSGACP00000007628
Sequence length 175
Comment (Gasterosteus aculeatus)
Sequence
MKTRLGCLSNKSDSYSDFSEFLPPAHETTARCLKVSTDEVVRWSESFDHLLSHKYGLAAF
RTFLKSEFSDENIEFWMACEEYKKIKSSTKLVSKANKIFQEFIDIQAPREVNIDYRTREK
TKQSLEDPSPTSLNEVQGKVYGLMEKDSYPRFLRSKMYQDMVNRANAHAEKTEGC
Download sequence
Identical sequences G3NQL2
69293.ENSGACP00000007628 ENSGACP00000007628 ENSGACP00000007628

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]