SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 69293.ENSGACP00000008514 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  69293.ENSGACP00000008514
Domain Number 1 Region: 4-187
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 9.3e-42
Family Calponin-homology domain, CH-domain 0.00000821
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 69293.ENSGACP00000008514
Sequence length 295
Comment (Gasterosteus aculeatus)
Sequence
MTTHFRSGPAFGLSAEVKSKLAGKYDHQKEEELRLWIQEVTGKRVGESFMESLKDGVLLC
ELINVLRPGSVRKISSSTQNWHQLENIGNFVRAITEFGLRPDDIFEANDLFENVNHTQVQ
STLIALAGMAKSKGFHSKYDLGVKYAEKQQRRFAPEKLKEGRNIIGLQMGTNKLASQKGM
TSYGTRRHLYDSKMATDGHVDQSTISLQMGTNKGASQAGMTAPGTRRHIFDKKLELENCD
SSTISLQMGTNKVASQQGMTSYGLPRQVYDNKYCANPTEAPCDNGAEFDGYQYSD
Download sequence
Identical sequences G3NT46
69293.ENSGACP00000008514 ENSGACP00000008514 ENSGACP00000008514

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]