SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 69293.ENSGACP00000011352 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  69293.ENSGACP00000011352
Domain Number 1 Region: 208-284
Classification Level Classification E-value
Superfamily GAS2 domain-like 4.18e-26
Family GAS2 domain 0.00019
Further Details:      
 
Domain Number 2 Region: 18-174
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 9.39e-26
Family Calponin-homology domain, CH-domain 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 69293.ENSGACP00000011352
Sequence length 312
Comment (Gasterosteus aculeatus)
Sequence
MADQSNIQSAASKSIRPFKSSEEYLYAMKEDLAEWLNTLYDLDVTADTFMDGLGTGCALC
RHANNVNRAAHDFQLEYPEAAQSMKMPSKEVVFQSRSVVCGSFVARDNVSNFISWCRQEL
WIKDVLMFETNDLVERCNEKNFVLCLLEVARRGSKFGMLAPMLIQLEEEIEEEIRDQKES
IHSVEDEEDEPDPEPFIWPQKRVLCDMRNLDELVREILGRCSCPAQFPMVKVSEGKYKVG
DSSALIFIRVLRTHVMVRVGGGWDTLEHYLDKHDPCRCAAFAHRYHQAKSSGQGAQSKSS
SAHSSRSTSPGP
Download sequence
Identical sequences G3P179
ENSGACP00000011352 69293.ENSGACP00000011352 ENSGACP00000011352

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]