SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 69293.ENSGACP00000011403 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  69293.ENSGACP00000011403
Domain Number 1 Region: 184-440
Classification Level Classification E-value
Superfamily YWTD domain 9.02e-43
Family YWTD domain 0.0000108
Further Details:      
 
Domain Number 2 Region: 58-96
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000131
Family LDL receptor-like module 0.00075
Further Details:      
 
Domain Number 3 Region: 97-142
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000639
Family EGF-type module 0.0072
Further Details:      
 
Domain Number 4 Region: 10-48
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000484
Family LDL receptor-like module 0.0022
Further Details:      
 
Weak hits

Sequence:  69293.ENSGACP00000011403
Domain Number - Region: 137-176
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000132
Family EGF-type module 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 69293.ENSGACP00000011403
Sequence length 443
Comment (Gasterosteus aculeatus)
Sequence
DWSDEASCPNCSAPDSFSCGPSDVCLPSNKLCDGRTDCRDGRDEARPACGPSPPRPQTSP
TCTPSEFHCGDGRCIRQTWRCDHSPDCSDGSDEDDCDQNECQVNNGGCSHRCVDQPLGFH
CDCPSSMRLVGDSQCEEVDPCLASDICDQLCVHNNGSLPCDCTEDYQMDLTTAECKAKGE
SAQLVFTSSKGVQLISITGSGYREPAPHLLGPGPVAALASNRTLYWARQGQSSLYRVSVD
GKTEDSVFVLKFQGSVSGLAVDWIHQLLYWTSMETGSVNVALLAGSAQRPLITGLDKPCA
VAVHPLKGLLFWAQCGSSPRIERSSLDGNDRMSVVVLSLRQPVALSLDMPRQLLYWVDRG
MRSISRVNLEGHHRKTVVESNGYLDRPFGLAVFEGFVYWSEEVTRSICRASKHNGGNLQV
LLSNITSPGGVLVIQPVLQPKGI
Download sequence
Identical sequences G3P1D0
ENSGACP00000011403 69293.ENSGACP00000011403 ENSGACP00000011403

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]