SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 69293.ENSGACP00000013553 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  69293.ENSGACP00000013553
Domain Number 1 Region: 1-130
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 2.09e-49
Family Calponin-homology domain, CH-domain 0.000000368
Further Details:      
 
Domain Number 2 Region: 210-270
Classification Level Classification E-value
Superfamily EB1 dimerisation domain-like 2.48e-19
Family EB1 dimerisation domain-like 0.0000613
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 69293.ENSGACP00000013553
Sequence length 280
Comment (Gasterosteus aculeatus)
Sequence
MAVNVYSTSVTSDNLSRHDMLVWINDSLQMNLTKIEMLCSGTAYCQFMDMLFPNSLPLKK
VKFGAKLEHEYIHNYKLLQVSFKKMGVDKIIPVDKLVKGKFQDNFEFVQWFKKFFDANYD
GKEYDPVEARQGQDAMPIPNNATSALTKTPKKALSPGQAAGWSCGLKCFSLVHILPLVAS
SAPQRPPVAKVAPKLALVSARKPKSDEERAELMNEVEILKSTIQDMEKERDFYFGKLRNI
ELICQEKEGEGDPTLQKIIDILYATDEGFVIPDAEEQEEF
Download sequence
Identical sequences G3P7H9
ENSGACP00000013553 69293.ENSGACP00000013553 ENSGACP00000013553

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]