SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 69293.ENSGACP00000014271 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  69293.ENSGACP00000014271
Domain Number 1 Region: 119-627
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 8.05e-144
Family Calponin-homology domain, CH-domain 0.00000000851
Further Details:      
 
Domain Number 2 Region: 5-94
Classification Level Classification E-value
Superfamily EF-hand 0.0000000000000221
Family Calmodulin-like 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 69293.ENSGACP00000014271
Sequence length 636
Comment (Gasterosteus aculeatus)
Sequence
MENHITQISRDDLDDLRDAFNKIDVDNSGFVSDFELQELFREASFSIPGYKVREIVEIFI
AGDTNKDEKISFEEFVSIFQELKSKELSETFRKSVKRRDGIRSFGGTSGNSSEGTQHSYS
DEEKVAFVNWINKALAKDKDCQHLLPMNPDDESLFTSVRDGILLCKMINHSQPDTIDERV
INTKKLATFTMTENLVLALNSASAIGCTVVSIDAHDLMAGKPHLVLGLLWQVIKVGLFAD
IEMKNEGLIGLLTDEENMDELMSLSPEELLLRWVNRHLRNAGTNTISNFSEDIKDSRAYF
HLLEQIALQEKQEHKLRVKIDMSGLSVRDLDQRAELMLQQAARLDCRQFVSPHDVTSGNS
KLNMAFVANLYNMHHGALKQINGGSSIGTIEPETNEEKTFRNWMNSLGVSPHVNHLYWDL
CDGLIIMQLYEKVNVPVDWKKVNNPPYPVLGANMKKLENCNYAVKLGRDVAHFSLVGIGG
ENLNEGSRMHTLALVWQLMRRYTVSVLSDQGQGGEKVEDQVILDWVNKTLSQKRKDTQIS
SFKFLQDKLISTSLPVIDLIDAIAPGTVKWDMVKRAQRGVLKEADKLNNAKYAISLARKI
GARVYAQPEDLVKVNPKMVMTLFASLMGHGLKKARR
Download sequence
Identical sequences G3P9J7
ENSGACP00000014271 69293.ENSGACP00000014271 ENSGACP00000014271

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]