SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 69293.ENSGACP00000014671 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  69293.ENSGACP00000014671
Domain Number 1 Region: 9-83
Classification Level Classification E-value
Superfamily SNARE fusion complex 2.27e-21
Family SNARE fusion complex 0.0000941
Further Details:      
 
Domain Number 2 Region: 147-220
Classification Level Classification E-value
Superfamily SNARE fusion complex 1.46e-20
Family SNARE fusion complex 0.0000865
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 69293.ENSGACP00000014671
Sequence length 223
Comment (Gasterosteus aculeatus)
Sequence
KPDSSNMDDMTVEQMAMRANHVTDESLESTRRMLQMAEESKQTGANTMVILDQQGEQLKR
VDEGMDQINQDMRQAERNLTDLSKCCGLCVCPCDRVSSIENDSKYKRTWGLRGGDGESDS
SGSKVVSRQPSGVRNGQAGQMNNSAPSGPYIKRITDDAREDEMEENLDAVGSIIGNLKTM
AQDMGNEIDQQNKHIDSITNKADMNRLRIDEANQRANKLLKCT
Download sequence
Identical sequences G3PAP7
ENSGACP00000014671 ENSGACP00000014671 69293.ENSGACP00000014671

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]